KEGG   Bos taurus (cow): 510244Help
Entry
510244            CDS       T01008                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
bta  Bos taurus (cow)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bta04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:bta04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 166 aa AA seqDB search
MLLEEVHAGDRLSGAAARGDVQEVRRLLHSELVHPDVLNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDASGTTPAHDAARTGFLDTLKVLVEHGADVNAPDGTGALPIHLAVREGHT
SVVSFLATESDLHHRDATGLTPLELARGRGAQELMDILQRHTVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaagaggtccacgccggcgaccggctgagcggggcggcggcccgaggagac
gtgcaggaggtgcgccgccttctgcacagcgagctggtgcacccagacgttctgaaccgc
tttggcaagacagcgctgcaggtcatgatgtttggcagtcccaccattgccctggaactc
ctgaagcaaggcgccagccccaacgtccaggatgcctcgggcaccactccggcccacgat
gcagcccgcactggattcctcgacactctaaaagtgctggtggagcacggcgccgatgtc
aacgcacccgatggcaccggggcgctccccatccacctggcagtgagagagggccacact
tctgtggtcagcttcctggctaccgaatctgatctccatcacagggacgccacggggctc
acacccctagagctggcacgggggagaggggcccaagagctcatggacatactgcagcgg
cacacggtggcacccctgtga

DBGET integrated database retrieval system