KEGG   Bos taurus (cow): 510434Help
Entry
510434            CDS       T01008                                 

Gene name
MAP2K2
Definition
mitogen-activated protein kinase kinase 2 (EC:2.7.12.2)
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Prion diseases
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    510434 (MAP2K2)
   04015 Rap1 signaling pathway
    510434 (MAP2K2)
   04010 MAPK signaling pathway
    510434 (MAP2K2)
   04012 ErbB signaling pathway
    510434 (MAP2K2)
   04370 VEGF signaling pathway
    510434 (MAP2K2)
   04066 HIF-1 signaling pathway
    510434 (MAP2K2)
   04068 FoxO signaling pathway
    510434 (MAP2K2)
   04024 cAMP signaling pathway
    510434 (MAP2K2)
   04022 cGMP - PKG signaling pathway
    510434 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    510434 (MAP2K2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    510434 (MAP2K2)
  Cellular commiunity
   04540 Gap junction
    510434 (MAP2K2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    510434 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    510434 (MAP2K2)
   04660 T cell receptor signaling pathway
    510434 (MAP2K2)
   04662 B cell receptor signaling pathway
    510434 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    510434 (MAP2K2)
  Endocrine system
   04910 Insulin signaling pathway
    510434 (MAP2K2)
   04912 GnRH signaling pathway
    510434 (MAP2K2)
   04915 Estrogen signaling pathway
    510434 (MAP2K2)
   04917 Prolactin signaling pathway
    510434 (MAP2K2)
   04921 Oxytocin signaling pathway
    510434 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    510434 (MAP2K2)
   04916 Melanogenesis
    510434 (MAP2K2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    510434 (MAP2K2)
  Nervous system
   04720 Long-term potentiation
    510434 (MAP2K2)
   04730 Long-term depression
    510434 (MAP2K2)
   04722 Neurotrophin signaling pathway
    510434 (MAP2K2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    510434 (MAP2K2)
   05206 MicroRNAs in cancer
    510434 (MAP2K2)
   05205 Proteoglycans in cancer
    510434 (MAP2K2)
   05214 Glioma
    510434 (MAP2K2)
   05216 Thyroid cancer
    510434 (MAP2K2)
   05221 Acute myeloid leukemia
    510434 (MAP2K2)
   05220 Chronic myeloid leukemia
    510434 (MAP2K2)
   05218 Melanoma
    510434 (MAP2K2)
   05211 Renal cell carcinoma
    510434 (MAP2K2)
   05219 Bladder cancer
    510434 (MAP2K2)
   05215 Prostate cancer
    510434 (MAP2K2)
   05213 Endometrial cancer
    510434 (MAP2K2)
   05223 Non-small cell lung cancer
    510434 (MAP2K2)
  Neurodegenerative diseases
   05020 Prion diseases
    510434 (MAP2K2)
  Infectious diseases
   05164 Influenza A
    510434 (MAP2K2)
   05161 Hepatitis B
    510434 (MAP2K2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     510434 (MAP2K2)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   510434 (MAP2K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 400 aa AA seqDB search
MLARRKPVLPALTINPAIAEGPSPTSEGASEAHLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPPSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccctaccagcgagggcgcctccgaagcacatctggtggacctccagaagaag
ctagaggagctagagctcgacgagcagcagaagaagcggctggaagccttccttacccag
aaggccaaggttggtgagctcaaggacgatgactttgaacggatctccgagctgggagcc
ggcaatggcggagtggtcaccaaggtccagcacagaccttcgggcctcatcatggccaga
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgagagctacag
gtgctgcatgagtgcaactccccgtacattgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgttgaaa
gaagccaagagaatccctgaagagatcctgggcaaggtcagcattgcggttctgcggggc
ctggcatacctccgggagaaacaccagatcatgcaccgagacgtgaagccgtccaacatc
ctggtcaactcccggggggagatcaagctgtgtgacttcggggtgagcggccagctcatc
gactccatggccaactccttcgtggggacgcggtcctacatgtctccggagcggctacaa
ggcacacactactcggtgcagtcagacatctggagcatgggcctgtccctggtggaactg
tccatcggcaggtaccccatccccccgccggacgccaaggagctggaggccatattcggc
cggcccatggttgatggcgcagaaggagaacctcctagcatctctccacggccgaggccc
cctggacgccccatcagcggtcacgggatggacagccggcctgccatggcgatctttgag
ctgctggactacattgtgaacgagcctcctcccaagctgcccaacggtgtgttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagctgagcgagcagacctg
aagatgctcatgaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgct
ggctggttgtgtaaaacactgcggctaaaccagcccagcacgcccacacgcaccgccgtg
tga

DBGET integrated database retrieval system