KEGG   Bos taurus (cow): 510618Help
Entry
510618            CDS       T01008                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
bta  Bos taurus (cow)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:bta04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:bta04115]
Cellular Processes; Cell communication; Tight junction [PATH:bta04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:bta04660]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:bta05212]
Human Diseases; Cancers; Glioma [PATH:bta05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:bta05220]
Human Diseases; Cancers; Melanoma [PATH:bta05218]
Human Diseases; Cancers; Bladder cancer [PATH:bta05219]
Human Diseases; Cancers; Small cell lung cancer [PATH:bta05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:bta05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:bta05166]
Human Diseases; Infectious diseases; Measles [PATH:bta05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:bta05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
DAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcccgatatgagccagtggctgagattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg
cggcgtctggaggcttttgagcatcccaatgttgtcaggcttatggacgtctgtgcaaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagatctc
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccataaaagatctg
atgcgccaatttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat
cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga
gatgtctctctaccccgaggagccttttccccccgagggccccgcccagtgcagtcggtg
gtccctgagctggaggaatctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt
gacgcagagtga

DBGET integrated database retrieval system