KEGG   Bos taurus (cow): 510618Help
Entry
510618            CDS       T01008                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04110  Cell cycle
bta04115  p53 signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04218  Cellular senescence
bta04530  Tight junction
bta04660  T cell receptor signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04934  Cushing's syndrome
bta05161  Hepatitis B
bta05162  Measles
bta05165  Human papillomavirus infection
bta05166  HTLV-I infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05212  Pancreatic cancer
bta05214  Glioma
bta05218  Melanoma
bta05219  Bladder cancer
bta05220  Chronic myeloid leukemia
bta05222  Small cell lung cancer
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
Module
bta_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    510618 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    510618 (CDK4)
   04115 p53 signaling pathway
    510618 (CDK4)
   04218 Cellular senescence
    510618 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    510618 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    510618 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    510618 (CDK4)
   05203 Viral carcinogenesis
    510618 (CDK4)
   05212 Pancreatic cancer
    510618 (CDK4)
   05225 Hepatocellular carcinoma
    510618 (CDK4)
   05214 Glioma
    510618 (CDK4)
   05220 Chronic myeloid leukemia
    510618 (CDK4)
   05218 Melanoma
    510618 (CDK4)
   05219 Bladder cancer
    510618 (CDK4)
   05224 Breast cancer
    510618 (CDK4)
   05222 Small cell lung cancer
    510618 (CDK4)
   05223 Non-small cell lung cancer
    510618 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    510618 (CDK4)
   04934 Cushing's syndrome
    510618 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    510618 (CDK4)
   05162 Measles
    510618 (CDK4)
   05161 Hepatitis B
    510618 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    510618 (CDK4)
   05165 Human papillomavirus infection
    510618 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    510618 (CDK4)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     510618 (CDK4)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CMGC group
  CDK family
   510618 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 510618
NCBI-ProteinID: NP_001032683
BGD-bta: BT19276
Ensembl: ENSBTAG00000007160
UniProt: Q32KY4
Position
5
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
DAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcccgatatgagccagtggctgagattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg
cggcgtctggaggcttttgagcatcccaatgttgtcaggcttatggacgtctgtgcaaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagatctc
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccataaaagatctg
atgcgccaatttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat
cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga
gatgtctctctaccccgaggagccttttccccccgagggccccgcccagtgcagtcggtg
gtccctgagctggaggaatctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt
gacgcagagtga

DBGET integrated database retrieval system