KEGG   Bos taurus (cow): 510679Help
Entry
510679            CDS       T01008                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bta  Bos taurus (cow)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    510679 (ALAD)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     510679 (ALAD)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   510679 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
8
AA seq 329 aa AA seqDB search
MHPQSVLHSGYFHPLLRNWQTAATSLSASNLIYPIFVTDVPDDKQPIASLPGVARYGVNR
LEEMLKPLVEEGLRCVLIFGVPSRVPKDERGSAADSEDSPAIEAIRLLRKNFPSLLVACD
VCLCPYTSHGHCGLLSENGSFQAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE
ALMAHGFGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADLLMVKPGTPYLDIVREVKNKHPELPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEVMTAFRRAGADVIITYYTPQLLQWLKE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctcagtcagttctgcacagcggctacttccacccactgctccggaactggcag
acagccgccaccagcctcagcgcctccaaccttatctaccccatctttgtcacggatgtt
cctgatgacaaacagcccatcgccagcctcccaggagtggccaggtacggtgtgaaccgg
ctggaagagatgctgaaacccctggtggaagagggcctgcgctgtgtcctgatctttggt
gtccccagcagagttcccaaggatgagcggggctctgcagccgactccgaggactccccg
gctatcgaggccatccgtctgttgcgcaagaatttccccagcctcctggtggcctgtgac
gtgtgcctatgtccctatacctcccacggtcactgcgggcttctgagtgagaacgggtca
ttccaagctgaggagagccgccagcggctggcagaggtggctctggcctatgccaaggcg
ggatgtcaggtggtggccccgtcggacatgatggacggacgcgtggaggccatcaaggaa
gctctgatggcacatggattcggcaacagggtatcagtgatgagctatagtgccaaattc
gcttcttgtttctatggacctttccgggacgcggctcagtcgagcccggcttttggagat
cgccgctgctaccagctgccacccggagcacgaggcctggccctccgcgcggtggaccgg
gatgttcgggagggagcagacttgctcatggtgaagccaggaacgccctacctggacatc
gtacgggaggtaaagaacaagcaccctgagctccccctggctgtgtaccacgtttctgga
gagtttgccatgctgtggcacggggcccaggccggggcatttgatctcaaggctgctgta
ctagaggtcatgactgctttccgcagagcaggtgccgatgtcatcattacctactacaca
cctcagctactgcagtggctgaaggagtga

DBGET integrated database retrieval system