KEGG   Bos taurus (cow): 510767Help
Entry
510767            CDS       T01008                                 

Gene name
CYCS, cytc
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
bta  Bos taurus (cow)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    510767 (CYCS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    510767 (CYCS)
   04115 p53 signaling pathway
    510767 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    510767 (CYCS)
   05210 Colorectal cancer
    510767 (CYCS)
   05222 Small cell lung cancer
    510767 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    510767 (CYCS)
   05012 Parkinson's disease
    510767 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    510767 (CYCS)
   05016 Huntington's disease
    510767 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    510767 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    510767 (CYCS)
  Infectious diseases
   05134 Legionellosis
    510767 (CYCS)
   05152 Tuberculosis
    510767 (CYCS)
   05164 Influenza A
    510767 (CYCS)
   05161 Hepatitis B
    510767 (CYCS)
   05168 Herpes simplex infection
    510767 (CYCS)
   05145 Toxoplasmosis
    510767 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag
atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa
aaagctaccaatgagtaa

DBGET integrated database retrieval system