KEGG   Bos taurus (cow): 510781Help
Entry
510781            CDS       T01008                                 

Gene name
JOSD1
Definition
Josephin domain containing 1 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 202 aa AA seqDB search
MSCVPWKGDKVKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGAIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGKSELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggagacaaggtcaaatctgaatcattggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctctgtgctctgcacgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggaaacgctgcaagagattttc
cagaggttgtcgccaaacaccatggtgaccccccacaagaagagcatgctgggaaatggg
aactacgatgtgaacgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgttggcgccattgctctcacaaacgttatgggcttcatcatg
aacctgccgtccagcctgtgctggggtcccctgaagctgccactcaaaaggcagcactgg
atctgtgttcgagaggtgggaggtgcctactacaacctggactccaaactgaagatgccc
gaatggattggaggcaagagcgagctcaggaagtttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtggaggcccatcagagctggagggct
gacgtgtga

DBGET integrated database retrieval system