KEGG   Bos taurus (cow): 510833Help
Entry
510833            CDS       T01008                                 

Gene name
COL3A1
Definition
collagen, type III, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    510833 (COL3A1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    510833 (COL3A1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    510833 (COL3A1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    510833 (COL3A1)
  Digestive system
   04974 Protein digestion and absorption
    510833 (COL3A1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    510833 (COL3A1)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  510833 (COL3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2q12
AA seq 1466 aa AA seqDB search
MMSFVQKGTWLLFALLHPTVILAQQEAVDGGCSHLGQSYADRDVWKPEPCQICVCDSGSV
LCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRN
GDPGPPGSPGSPGSPGPPGICESCPTGGQNYSPQYEAYDVKSGVAGGGIAGYPGPAGPPG
PPGPPGTSGHPGAPGAPGYQGPPGEPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPGRPG
ERGFPGPPGMKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGVPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPG
SSGAPGQRGEPGPQGHAGAPGPPGPPGSNGSPGGKGEMGPAGIPGAPGLIGARGPPGPPG
TNGVPGQRGAAGEPGKNGAKGDPGPRGERGEAGSPGIAGPKGEDGKDGSPGEPGANGLPG
AAGERGVPGFRGPAGANGLPGEKGPPGDRGGPGPAGPRGVAGEPGRDGLPGGPGLRGIPG
SPGGPGSDGKPGPPGSQGETGRPGPPGSPGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPAGKNGETGPQGPPGPTGPSGDKGDTGPPGPQGLQGLPGTSGPPGENGKPGEPG
PKGEAGAPGIPGGKGDSGAPGERGPPGAGGPPGPRGGAGPPGPEGGKGAAGPPGPPGSAG
TPGLQGMPGERGGPGGPGPKGDKGEPGSSGVDGAPGKDGPRGPTGPIGPPGPAGQPGDKG
ESGAPGVPGIAGPRGGPGERGEQGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPG
AAGPAGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGGRGPPGPPGSNGNPGPPGSSGAPG
KDGPPGPPGSNGAPGSPGISGPKGDSGPPGERGAPGPQGPPGAPGPLGIAGLTGARGLAG
PPGMPGARGSPGPQGIKGENGKPGPSGQNGERGPPGPQGLPGLAGTAGEPGRDGNPGSDG
LPGRDGAPGAKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGETGPAGPSGAPGPAG
SRGPPGPQGPRGDKGETGERGAMGIKGHRGFPGNPGAPGSPGPAGHQGAVGSPGPAGPRG
PVGPSGPPGKDGASGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGAG
GVAAIAGVGAEKAGGFAPYYGDEPIDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPAR
NCRDLKFCHPELQSGEYWVDPNQGCKLDAIKVYCNMETGETCISASPLTIPQKNWWTDSG
AEKKHVWFGESMEGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMD
HASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWGKTVFQYQTRKAVRLP
IVDIAPYDIGGPDQEFGADIGPVCFL
NT seq 4401 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctttgtgcaaaaggggacctggttacttttcgctctgcttcatcccactgtt
attttggcacaacaggaagctgttgacggaggatgctcccatctcggtcagtcttatgca
gatagagatgtatggaaaccagaaccgtgccaaatatgcgtctgtgactcaggatccgtt
ctctgtgatgacataatatgtgacgaccaagaattagactgccccaaccctgaaatcccg
tttggagaatgttgtgcagtttgcccacagcctccaacagctcccactcgccctcctaat
ggtcaaggacctcaaggccccaagggagatccaggtcctcctggtattcctgggcgaaat
ggcgatcctggtcctccaggatcaccaggctccccaggttctcccggccctcctggaatc
tgtgaatcatgtcctactggtggccagaactattctccccagtacgaagcatatgatgtc
aagtctggagtagcaggaggaggaatcgcaggctatcctgggccagctggtcctcctggc
ccacccggaccccctggcacatctggccatcctggtgcccctggcgctccaggataccaa
ggtccccccggtgaacctgggcaagctggtccggcaggtcctccaggacctcctggtgct
ataggtccatctggccctgctggaaaagatggggaatcaggaagacccggacgacctgga
gagcgaggatttcctggccctcctggtatgaaaggcccagctggtatgcctggattccct
ggtatgaaaggacacagaggctttgatggacgaaatggagagaaaggcgaaactggtgct
cctggattaaagggggaaaatggcgttccaggtgaaaatggagctcctggacccatgggt
ccaagaggggctcccggtgagagaggacggccaggacttcctggagccgcaggggctcga
ggtaatgatggagctcgaggaagtgatggacaaccgggcccccctggtcctcctggaact
gcaggattccctggttcccctggtgctaagggtgaagttggacctgcaggatctcctggt
tcaagtggcgcccctggacaaagaggagaacctggacctcagggacatgctggtgctcca
ggtccccctgggcctcctgggagtaatggtagtcctggtggcaaaggtgaaatgggtcct
gctggcattcctggggctcctgggctgataggagctcgtggtcctccagggccacctggc
accaatggtgttcccgggcaacgaggtgctgcaggtgaacccggtaagaatggagccaaa
ggagacccaggaccacgtggggaacgcggagaagctggttctccaggtatcgcaggacct
aagggtgaagatggcaaagatggttctcctggagaacctggtgcaaatggacttcctgga
gctgcaggagaaaggggtgtgcctggattccgaggacctgctggagcaaatggccttcca
ggagaaaagggtcctcctggggaccgtggtggcccaggccctgcagggcccagaggtgtt
gctggagagcccggcagagatggtctccctggaggtccaggattgaggggtattcctggt
agccccggaggaccaggcagtgatgggaaaccagggcctcctggaagccaaggagagacg
ggtcgacccggtcctccaggttcacctggtccgcgaggccagcctggtgtcatgggcttc
cctggtcccaaaggaaacgatggtgctcctggaaaaaatggagaacgaggtggccctgga
ggtcctggccctcagggtcctgctggaaagaatggtgagaccggacctcagggtcctcca
ggacctactggcccttctggtgacaaaggagacacaggaccccctggtccacaaggacta
caaggcttgcctggaacgagtggtcccccaggagaaaacggaaaacctggtgaacctggt
ccaaagggtgaggctggtgcacctggaattccaggaggcaagggtgattctggtgctccc
ggtgaacgcggacctcctggagcaggagggccccctggacctagaggtggagctggcccc
cctggtcccgaaggaggaaagggtgctgctggtccccctgggccacctggttctgctggt
acacctggtctgcaaggaatgcctggagaaagagggggtcctggaggccctggtccaaag
ggtgataagggtgagcctggcagctcaggtgtcgatggtgctccagggaaagatggtcca
cggggtcccactggtcccattggtcctcctggcccagctggtcagcctggagataagggt
gaaagtggtgcccctggagttccgggtatagctggtcctcgcggtggccctggtgagaga
ggcgaacaggggcccccaggacctgctggcttccctggtgctcctggccagaatggtgag
cctggtgctaaaggagaaagaggcgctcctggtgagaaaggtgaaggaggccctcccgga
gccgcaggacccgccggaggttctgggcctgccggtcccccaggcccccaaggtgtcaaa
ggcgaacgtggcagtcctggtggtcctggtgctgctggcttccccggtggtcgtggtcct
cctggccctcctggcagtaatggtaacccaggccccccaggctccagtggtgctccaggc
aaagatggtcccccaggtccacctggcagtaatggtgctcctggcagccccgggatctct
ggaccaaagggtgattctggtccaccaggtgagaggggagcacctggcccccagggccct
ccgggagctccaggcccactaggaattgcaggacttactggagcacgaggtcttgcaggc
ccaccaggcatgccaggtgctaggggcagccccggcccacagggcatcaagggtgaaaat
ggtaaaccaggacctagtggtcagaatggagaacgtggtcctcctggcccccagggtctt
cctggtctggctggtacagctggtgagcctggaagagatggaaaccctggatcagatggt
ctgccaggccgagatggagctccaggtgccaagggtgaccgtggtgaaaatggctctcct
ggtgcccctggagctcctggtcacccaggccctcctggtcctgtcggtccagctggaaag
agcggtgacagaggagaaactggccctgctggtccttctggggcccccggtcctgccgga
tcaagaggtcctcctggtccccaaggcccacgcggtgacaaaggggaaaccggtgagcgt
ggtgctatgggcatcaaaggacatcgcggattccctggcaacccaggggcccccggatct
ccgggtcccgctggtcatcaaggtgcagttggcagtccaggccctgcaggccccagagga
cctgttggacctagcgggccccctggaaaggacggagcaagtggacaccctggtcccatt
ggaccaccggggccccgaggtaacagaggtgaaagaggatctgagggctccccaggccac
ccaggacaaccaggccctcctggacctcctggtgcccctggtccatgttgtggtgctggc
ggggttgctgccattgctggtgttggagccgaaaaagctggtggttttgccccatattat
ggagatgaaccgatagatttcaaaatcaacaccgatgagattatgacctcactcaaatca
gtcaatggacaaatagaaagcctcattagtcctgatggttcccgtaaaaaccctgcacgg
aactgcagggacctgaaattctgccatcctgaactccagagtggagaatattgggttgat
cctaaccaaggttgcaaattggatgctattaaagtctactgtaacatggaaactggggaa
acgtgcataagtgccagtcctttgactatcccacagaagaactggtggacagattctggt
gctgagaagaaacatgtttggtttggagaatccatggagggtggttttcagtttagctat
ggcaatcctgaacttcccgaagacgtcctcgatgtccagctggcattcctccgacttctc
tccagccgggcctctcagaacatcacatatcactgcaagaatagcattgcatacatggat
catgccagtgggaatgtaaagaaagccttgaagctgatggggtcaaatgaaggtgaattc
aaggctgaaggaaatagcaaattcacatacacagttctggaggatggttgcacaaaacac
actggggaatggggcaaaacagtcttccagtatcaaacacgcaaggccgtcagactacct
attgtagatattgcaccctatgatatcggtggtcctgatcaagaatttggtgcggacatt
ggccctgtttgctttttataa

DBGET integrated database retrieval system