KEGG   Bos taurus (cow): 510833Help
Entry
510833            CDS       T01008                                 

Gene name
COL3A1
Definition
(RefSeq) collagen type III alpha 1
  KO
K19720  
collagen, type III, alpha
Organism
bta  Bos taurus (cow)
Pathway
Platelet activation
AGE-RAGE signaling pathway in diabetic complications
Protein digestion and absorption
Amoebiasis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Immune system
   04611 Platelet activation
    510833 (COL3A1)
  Digestive system
   04974 Protein digestion and absorption
    510833 (COL3A1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    510833 (COL3A1)
  Infectious diseases
   05146 Amoebiasis
    510833 (COL3A1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   510833 (COL3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2q12
AA seq 1466 aa AA seqDB search
MMSFVQKGTWLLFALLHPTVILAQQEAVDGGCSHLGQSYADRDVWKPEPCQICVCDSGSV
LCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRN
GDPGPPGSPGSPGSPGPPGICESCPTGGQNYSPQYEAYDVKSGVAGGGIAGYPGPAGPPG
PPGPPGTSGHPGAPGAPGYQGPPGEPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPGRPG
ERGFPGPPGMKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGVPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPG
SSGAPGQRGEPGPQGHAGAPGPPGPPGSNGSPGGKGEMGPAGIPGAPGLIGARGPPGPPG
TNGVPGQRGAAGEPGKNGAKGDPGPRGERGEAGSPGIAGPKGEDGKDGSPGEPGANGLPG
AAGERGVPGFRGPAGANGLPGEKGPPGDRGGPGPAGPRGVAGEPGRDGLPGGPGLRGIPG
SPGGPGSDGKPGPPGSQGETGRPGPPGSPGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPAGKNGETGPQGPPGPTGPSGDKGDTGPPGPQGLQGLPGTSGPPGENGKPGEPG
PKGEAGAPGIPGGKGDSGAPGERGPPGAGGPPGPRGGAGPPGPEGGKGAAGPPGPPGSAG
TPGLQGMPGERGGPGGPGPKGDKGEPGSSGVDGAPGKDGPRGPTGPIGPPGPAGQPGDKG
ESGAPGVPGIAGPRGGPGERGEQGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPG
AAGPAGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGGRGPPGPPGSNGNPGPPGSSGAPG
KDGPPGPPGSNGAPGSPGISGPKGDSGPPGERGAPGPQGPPGAPGPLGIAGLTGARGLAG
PPGMPGARGSPGPQGIKGENGKPGPSGQNGERGPPGPQGLPGLAGTAGEPGRDGNPGSDG
LPGRDGAPGAKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGETGPAGPSGAPGPAG
SRGPPGPQGPRGDKGETGERGAMGIKGHRGFPGNPGAPGSPGPAGHQGAVGSPGPAGPRG
PVGPSGPPGKDGASGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGAG
GVAAIAGVGAEKAGGFAPYYGDEPIDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPAR
NCRDLKFCHPELQSGEYWVDPNQGCKLDAIKVYCNMETGETCISASPLTIPQKNWWTDSG
AEKKHVWFGESMEGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMD
HASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWGKTVFQYQTRKAVRLP
IVDIAPYDIGGPDQEFGADIGPVCFL
NT seq 4401 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctttgtgcaaaaggggacctggttacttttcgctctgcttcatcccactgtt
attttggcacaacaggaagctgttgacggaggatgctcccatctcggtcagtcttatgca
gatagagatgtatggaaaccagaaccgtgccaaatatgcgtctgtgactcaggatccgtt
ctctgtgatgacataatatgtgacgaccaagaattagactgccccaaccctgaaatcccg
tttggagaatgttgtgcagtttgcccacagcctccaacagctcccactcgccctcctaat
ggtcaaggacctcaaggccccaagggagatccaggtcctcctggtattcctgggcgaaat
ggcgatcctggtcctccaggatcaccaggctccccaggttctcccggccctcctggaatc
tgtgaatcatgtcctactggtggccagaactattctccccagtacgaagcatatgatgtc
aagtctggagtagcaggaggaggaatcgcaggctatcctgggccagctggtcctcctggc
ccacccggaccccctggcacatctggccatcctggtgcccctggcgctccaggataccaa
ggtccccccggtgaacctgggcaagctggtccggcaggtcctccaggacctcctggtgct
ataggtccatctggccctgctggaaaagatggggaatcaggaagacccggacgacctgga
gagcgaggatttcctggccctcctggtatgaaaggcccagctggtatgcctggattccct
ggtatgaaaggacacagaggctttgatggacgaaatggagagaaaggcgaaactggtgct
cctggattaaagggggaaaatggcgttccaggtgaaaatggagctcctggacccatgggt
ccaagaggggctcccggtgagagaggacggccaggacttcctggagccgcaggggctcga
ggtaatgatggagctcgaggaagtgatggacaaccgggcccccctggtcctcctggaact
gcaggattccctggttcccctggtgctaagggtgaagttggacctgcaggatctcctggt
tcaagtggcgcccctggacaaagaggagaacctggacctcagggacatgctggtgctcca
ggtccccctgggcctcctgggagtaatggtagtcctggtggcaaaggtgaaatgggtcct
gctggcattcctggggctcctgggctgataggagctcgtggtcctccagggccacctggc
accaatggtgttcccgggcaacgaggtgctgcaggtgaacccggtaagaatggagccaaa
ggagacccaggaccacgtggggaacgcggagaagctggttctccaggtatcgcaggacct
aagggtgaagatggcaaagatggttctcctggagaacctggtgcaaatggacttcctgga
gctgcaggagaaaggggtgtgcctggattccgaggacctgctggagcaaatggccttcca
ggagaaaagggtcctcctggggaccgtggtggcccaggccctgcagggcccagaggtgtt
gctggagagcccggcagagatggtctccctggaggtccaggattgaggggtattcctggt
agccccggaggaccaggcagtgatgggaaaccagggcctcctggaagccaaggagagacg
ggtcgacccggtcctccaggttcacctggtccgcgaggccagcctggtgtcatgggcttc
cctggtcccaaaggaaacgatggtgctcctggaaaaaatggagaacgaggtggccctgga
ggtcctggccctcagggtcctgctggaaagaatggtgagaccggacctcagggtcctcca
ggacctactggcccttctggtgacaaaggagacacaggaccccctggtccacaaggacta
caaggcttgcctggaacgagtggtcccccaggagaaaacggaaaacctggtgaacctggt
ccaaagggtgaggctggtgcacctggaattccaggaggcaagggtgattctggtgctccc
ggtgaacgcggacctcctggagcaggagggccccctggacctagaggtggagctggcccc
cctggtcccgaaggaggaaagggtgctgctggtccccctgggccacctggttctgctggt
acacctggtctgcaaggaatgcctggagaaagagggggtcctggaggccctggtccaaag
ggtgataagggtgagcctggcagctcaggtgtcgatggtgctccagggaaagatggtcca
cggggtcccactggtcccattggtcctcctggcccagctggtcagcctggagataagggt
gaaagtggtgcccctggagttccgggtatagctggtcctcgcggtggccctggtgagaga
ggcgaacaggggcccccaggacctgctggcttccctggtgctcctggccagaatggtgag
cctggtgctaaaggagaaagaggcgctcctggtgagaaaggtgaaggaggccctcccgga
gccgcaggacccgccggaggttctgggcctgccggtcccccaggcccccaaggtgtcaaa
ggcgaacgtggcagtcctggtggtcctggtgctgctggcttccccggtggtcgtggtcct
cctggccctcctggcagtaatggtaacccaggccccccaggctccagtggtgctccaggc
aaagatggtcccccaggtccacctggcagtaatggtgctcctggcagccccgggatctct
ggaccaaagggtgattctggtccaccaggtgagaggggagcacctggcccccagggccct
ccgggagctccaggcccactaggaattgcaggacttactggagcacgaggtcttgcaggc
ccaccaggcatgccaggtgctaggggcagccccggcccacagggcatcaagggtgaaaat
ggtaaaccaggacctagtggtcagaatggagaacgtggtcctcctggcccccagggtctt
cctggtctggctggtacagctggtgagcctggaagagatggaaaccctggatcagatggt
ctgccaggccgagatggagctccaggtgccaagggtgaccgtggtgaaaatggctctcct
ggtgcccctggagctcctggtcacccaggccctcctggtcctgtcggtccagctggaaag
agcggtgacagaggagaaactggccctgctggtccttctggggcccccggtcctgccgga
tcaagaggtcctcctggtccccaaggcccacgcggtgacaaaggggaaaccggtgagcgt
ggtgctatgggcatcaaaggacatcgcggattccctggcaacccaggggcccccggatct
ccgggtcccgctggtcatcaaggtgcagttggcagtccaggccctgcaggccccagagga
cctgttggacctagcgggccccctggaaaggacggagcaagtggacaccctggtcccatt
ggaccaccggggccccgaggtaacagaggtgaaagaggatctgagggctccccaggccac
ccaggacaaccaggccctcctggacctcctggtgcccctggtccatgttgtggtgctggc
ggggttgctgccattgctggtgttggagccgaaaaagctggtggttttgccccatattat
ggagatgaaccgatagatttcaaaatcaacaccgatgagattatgacctcactcaaatca
gtcaatggacaaatagaaagcctcattagtcctgatggttcccgtaaaaaccctgcacgg
aactgcagggacctgaaattctgccatcctgaactccagagtggagaatattgggttgat
cctaaccaaggttgcaaattggatgctattaaagtctactgtaacatggaaactggggaa
acgtgcataagtgccagtcctttgactatcccacagaagaactggtggacagattctggt
gctgagaagaaacatgtttggtttggagaatccatggagggtggttttcagtttagctat
ggcaatcctgaacttcccgaagacgtcctcgatgtccagctggcattcctccgacttctc
tccagccgggcctctcagaacatcacatatcactgcaagaatagcattgcatacatggat
catgccagtgggaatgtaaagaaagccttgaagctgatggggtcaaatgaaggtgaattc
aaggctgaaggaaatagcaaattcacatacacagttctggaggatggttgcacaaaacac
actggggaatggggcaaaacagtcttccagtatcaaacacgcaaggccgtcagactacct
attgtagatattgcaccctatgatatcggtggtcctgatcaagaatttggtgcggacatt
ggccctgtttgctttttataa

DBGET integrated database retrieval system