KEGG   Bos taurus (cow): 510841Help
Entry
510841            CDS       T01008                                 

Gene name
PDK3
Definition
pyruvate dehydrogenase kinase, isozyme 3 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 415 aa AA seqDB search
MRLFRLLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPENLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKSTAEADDWSNPSSEPRDASKYKAKQDKMKTNRTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgttccggttgctgctgaagcagccggtgcccaagcagattgagcgctactcg
cgcttctcgccgtcgccgctctccatcaagcagttcctggacttcgggagagataatgcg
tgtgagaaaacttcgtatatgttcctacgaaaggagcttcctgtgcgcctggctaacaca
atgagagaagttaatcttctgccggagaacttgcttaaccgcccttcggtgggattggtt
cagagctggtatatgcagagttttcttgaacttctagaatatgaaaataagagccctgaa
gatccgcaggtcttggataactttctccaagtcctaattaaagtcagaaatagacacaat
gatgtggttcctacaatggcccaaggagtgatcgagtacaaggagaagtttgggtttgat
ccattcattagcagtaacatccagtattttctggaccgattttataccaaccgcatctct
ttccgcatgcttattaaccagcacacacttctgtttggcggtgacaccaatcctgtgcat
ccgaaacacatcggaagtattgatcccacctgcaacgttgctgatgttgtgaaagatgcg
tatgaaaccgccaagatgctttgtgaacagtattatctggtagctccagagctggaagtt
gaagaattcaatgccaaagctccaaacaaacctattcaggtagtttatgtgccctcacac
ctctttcacatgctctttgagttgttcaagaactcaatgagagcaacagttgaactatat
gaagatagaaaagagggctacccagctgttaaaaccctggttactctgggtaaagaagac
ttatccattaagataagtgacctaggtggtggggttccactccgaaaaatagatcgcctt
tttaactacatgtattcaactgctccgagacctagcctggagcctacccgagctgcccca
ttggctggatttggttatggcttgccaatttctcgtctgtatgctagatattttcaagga
gatctaaagctctattctatggaaggcgtgggtactgatgctgtcatttatttaaaggcc
ctttcaagtgaatcatttgagagacttccggtttttaacaagtccgcatggcgccattac
aagagcacagctgaagctgacgattggagcaatcccagcagtgagcccagggacgcttcc
aaatacaaggcaaaacaggacaagatgaagactaacagaactttgtaa

DBGET integrated database retrieval system