KEGG   Bos taurus (cow): 511121Help
Entry
511121            CDS       T01008                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1375 aa AA seqDB search
MVPGEENQLVPKEDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERI
TLNLPASTPLRKLFEDVANKVGYINGTFDLVWGNGINTADMAPLDHTSDKSLLDANFEPG
KKNFLHLTDKDGEQPQILLEDSSAGDDSVHDKFIGPLPREGSVGSTSDYVSQSYSYSSIL
NKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLF
VLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINEL
YQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPN
QYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF
IDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLENNSGTEKIPKPGL
EKNSLIYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSS
GSRGYYSSAFASSTNAYMLIYRLKDPARNAKFLEVDEYPEHIKNLVQRERELEEQEKRQR
EIERNTCKIKLFCLHPVKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPMDCCRLVK
YDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRRPDQVFQSYKPGEVMVKVHV
VDLKAESVAAPITVRAYLNETVTEFKQLISKAVHLPAETMRVVLERCYNDLRLLTVPSKT
LKNEGFFRSNKVFVESSETLDYQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSFSKRT
AYQKAGGDSGNVGDDCERVKGPAGSLKSVEAILEESTEKLKSLSLQQQQEGDNGDSSKST
ETSDFENIESPLNERGSSASVDNRELEQHMQTSDPENFQSEERSDSDVNNDRSTSSVDSD
ILSSSHSSDTLCNADNAQIPLANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYD
ESGKSRGEIQYMYFKAEPYAADEGSGEGHKWLMVHVDKRITLATFKQHLEPFVGVLSSHF
KVFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKF
LLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDI
NISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWRPSEMKLDPFQEVVLESSSVDELRDKLY
EISGIPVEDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDR
REELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 4128 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaggaggatgtgttttggagatgcaga
caaaatatctttgatgaaatgaagaagaaatttttacagatagaaaatgctgctgaagaa
ccaagagtcttatgtataatacaagatactactaattcaaagacggtgaatgaacggatc
actttaaacttaccagcttctactccactcagaaagctctttgaagatgtggccaacaaa
gtaggctacataaatggaacctttgatttggtgtgggggaatggaatcaatactgctgat
atggctccactggatcataccagtgataagtctcttcttgatgctaattttgagccagga
aagaagaactttctgcatttgacagataaagatggtgaacagcctcagatactgctggag
gattccagtgctggggatgacagtgttcatgacaaatttattggtccacttccaagagaa
ggttctgtgggctctaccagtgattatgtcagccaaagctactcctattcatctattttg
aataaatcagaaactggatacgtgggattagtaaaccaagcaatgacttgctatttgaat
agccttttgcaaacactttttatgactcctgaatttaggaatgcattatataagtgggaa
tttgaagaatctgaagaagatccagtgacaagtatcccataccaacttcagaggcttttt
gttttgttacaaaccagcaaaaagagagcaattgaaaccacagatgttacaaggagcttt
ggatgggatagtagtgaggcttggcagcagcatgatgtacaagaactgtgcagagtcatg
tttgatgctttggaacagaaatggaaacaaacagaacaggctgatcttataaatgaactg
taccaaggcaagctgaaggactacgtgagatgtctggaatgtggctatgagggttggaga
atcgacacataccttgatattccattggtcatccggccttatgggtccagccaggcgttt
gctagtgtggaagaagcattgcatgcatttattcagccagagatcctggatggcccaaat
caatatttttgtgaacgttgtaagaagaagtgtgatgcacgaaaggggcttcggtttttg
catttcccttatcttctgaccttacaattgaaaaggtttgattttgactatacaaccatg
cacaggattaaattgaatgatcggatgacgtttcctgaggaactagatatgagtacattt
attgatgttgaggatgagaagtctcctcagactgaaagttgcactgacagtggagccgaa
aatgaaggcagttgtcacagtgatcagatgagcaatgatttctccaatgacgacggcgtt
gatgaaggaatctgccttgaaaacaatagcggaactgaaaagattccaaaacctggactt
gagaagaattccttgatctatgagctcttctccgttatggttcattcagggagtgctgct
ggtggccattattatgcttgcataaagtctttcagtgatgagcaatggtacagcttcaac
gatcaacatgtcagcaggataacacaagaggacattaagaaaacacacggtggatcttca
ggaagcagaggatattactccagtgcttttgcaagctccacaaatgcatatatgctgata
tatagattgaaggacccagcaagaaatgcaaaatttctagaagtagatgagtatccagaa
catattaaaaacttggtgcagagagagagagaattggaagaacaagaaaagaggcaacga
gaaattgagcgcaatacatgcaagataaaattattctgtttgcatcctgtgaaacaagtg
atgatggaaaataaattggaggttcataaggataagacactaaaggaagcagtagaaatg
gcttataagatgatggatttagaagaggtaatacccatggattgctgtcgtcttgttaaa
tatgacgagtttcatgattatcttgaacgatcatatgaaggagaagaagatactccaatg
ggtcttttactaggtggagtcaagtcaacatacatgtttgatctgctgttggagacaaga
agacctgatcaagttttccagtcttataaacctggagaagtaatggtgaaagttcatgtt
gttgatctaaaggcagaatctgtagctgctcctatcactgttcgagcttacttaaatgaa
acagttacagaattcaaacagcttatatcaaaggccgtccatttacctgctgagacaatg
agagtagtgctggagcgctgctacaatgacttgcgccttctcactgtgcccagtaaaacc
ctgaaaaacgaagggttttttagaagtaataaggtgtttgttgaaagctctgagactctg
gattaccagatggcctttacagactctcatttatggaaactcctggatcggcatgcaaat
acaatcagattatttgttttgctacctgaacaatctccaggatctttttccaaaaggaca
gcataccagaaagctgggggtgactctgggaacgtgggtgatgactgtgaaagagtcaaa
ggacctgcagggagcctaaagtctgtggaagctattctagaagaaagcactgaaaaactc
aaaagcttgtcactgcagcagcagcaggagggagataatggggacagcagcaagagtact
gagacaagtgactttgaaaacattgaatcacctctcaatgagaggggctcctcagcctca
gtggataatagagaacttgaacagcatatgcagacttctgatcctgaaaattttcagtct
gaagagcgatcagattcagatgtgaataatgataggagtacaagttcggtggacagtgat
attcttagctcgagtcatagcagtgatactttgtgcaatgcagataatgcccagatccct
ttggctaatggacttgactctcacagcatcacgagtagtagaagaactaaagcgaacgaa
gggaaaaaggagacatgggatacagcagaagaagactctggaacggacagtgaatatgat
gagagtggcaagagtaggggagaaatacagtacatgtatttcaaagcagagccctatgct
gcagatgaaggttctggggaaggacataaatggttgatggtgcatgttgacaaaagaatt
actctggccactttcaaacaacatttagagccctttgttggagttctgtcctctcacttc
aaggtctttcgcgtgtacgccagcaatcaagagtttgagagcgtccggctgaatgagaca
ctttcatcgttttcagatgacaataagattacaattagactgggaagagcacttaaaaaa
ggagaatacagagttaaagtgtaccagcttctagtcaatgaacaagagccatgcaagttt
ctgctagacgctgtttttgctaaaggaatgactgtacggcaatcaaaagaggagttaatt
cctcagctcagggagcagtgtggtttagagctcagtattgacaggtttcgtctaaggaaa
aaaacatggaagaatcctggcactgtctttttggattatcatatttatgaagaagatatt
aatatttccagcaactgggaggttttccttgaagttcttgatggggtggagaagatgaaa
tccatgtcacaacttgcagttttgtcaagacggtggaggccttcagagatgaagttggat
cccttccaggaggttgtgttggaaagcagtagtgttgatgagttgcgagataagctttat
gaaatcagtggaattcctgtagaagatattgagtttgccaagggtagaggaacttttccc
tgtgatatttctgtcctggatattcatcaggatttggactggaatcccaaagtttctacc
ctgaatgtctggcctctttatatctgtgatgatggtgcagtcatattttatagggataga
agagaagaattaatggagttgacagacgagcagagaaatgaactgatgaaaaaagaaagc
agtcgactccagaaaacaggacatcgtgtaacatactcacctcggaaagagaaagcacta
aaaatttatctggatggagcaccaaataaagatctaactcaagactga

DBGET integrated database retrieval system