KEGG   Bos taurus (cow): 511299Help
Entry
511299            CDS       T01008                                 

Gene name
SETMAR
Definition
SET domain without mariner transposase fusion (EC:2.1.1.43)
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    511299 (SETMAR)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     511299 (SETMAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 306 aa AA seqDB search
MATCEEVPEALKGQLDVARGLENLPVSAWPPGAEPEPFQYTPDHVAGPGADADPSQITFP
GCACLKTPCLPGTCSCLRHENNYDDRSCLRDIGSEAKCTEPVFECNVLCQCSERCRNRVV
QWGLQFHLQVFKTDHKGWGLRTLDFIPKGRFVCEYAGEVLGISEVQRRVQLQTIHDSNYI
IAIREHVYNGQVMETFVDPASIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAARDIL
PEEELSYDYSGRFLNLMHSEDKERLDNGKLRKPCYCGARSCAAFLPYDSSLYCPTEKPDT
SEEGRA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtgtgaggaggtgcctgaggccttgaagggccagctggacgttgcgcgtggc
cttgaaaatctgcctgtgagcgcctggcccccaggggcggagcctgagccctttcagtat
actcctgatcatgtagctgggcctggagcagatgcagatccctctcaaataacctttcct
ggatgtgcttgtctcaaaactccctgcctccctggtacttgttcctgtctccgtcatgag
aataactatgatgatcgttcatgcctcagagatataggatccgaagcaaagtgcactgag
ccagttttcgagtgcaatgtcctgtgccagtgcagcgagcgctgcaggaacagagtggtc
cagtggggtctgcagttccacctccaggtgttcaagacggatcacaaaggctggggactt
cgtaccctggacttcataccaaaaggacggtttgtctgtgaatatgccggtgaggtgtta
ggaatctctgaagtgcagagaagagttcagttacaaacaatacatgattcgaattacatt
atagccatcagggagcatgtctataatgggcaggtaatggaaacatttgtggatcctgcc
tctataggaaatattggaagattccttaaccattcttgtgagccaaacctgttgatgatt
cctgtccgaatagactcgatggtaccaaagttggcactttttgcagccagagacattctg
ccagaagaagaactctcttatgactactcaggaagatttcttaatctaatgcatagtgaa
gacaaagaaaggttagataatgggaaattaaggaaaccttgttattgtggtgccagatca
tgtgctgcgttcctgccctatgacagctccctgtactgccccacagaaaagccagacacg
agtgaggaaggaagagcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system