KEGG   Bos taurus (cow): 511470Help
Entry
511470            CDS       T01008                                 

Gene name
CYP1B1
Definition
(RefSeq) cytochrome P450, family 1, subfamily B, polypeptide 1
  KO
K07410  cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
bta00380  Tryptophan metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta04913  Ovarian steroidogenesis
bta05204  Chemical carcinogenesis
bta05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    511470 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    511470 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    511470 (CYP1B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    511470 (CYP1B1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    511470 (CYP1B1)
   05204 Chemical carcinogenesis
    511470 (CYP1B1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     511470 (CYP1B1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP1 family
   511470 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 511470
NCBI-ProteinID: NP_001179223
BGD-bta: BT28162
Ensembl: ENSBTAG00000010531
UniProt: F1MNG1
Position
11
AA seq 539 aa AA seqDB search
MATGLSPDDHLSPTLLSVQQTMLLLLLSVLAAVHVGQWLLRQRRRQPGSAPPGPFAWPLI
GNAASMGSAPHLLFARLARRYGDVFQIHLGSCRVVVLNGERAIRQALVHQSAAFADRPPF
ASFRLVSGGRSLAFGQYSESWKAQRRAAHSTMRAFSTRQPRGRRVLEGHVVGEVRELVEL
LVRRSAGGAFLDPRPLTLVAVANVMSALCFGCRYSHDDAEFLELLSHNEEFGRTVGAGSL
VDVLPWLQRFPNPVRTAFREFEQLNRNFSNFVLDKFLRHRESLRPGAAPRDMMDAFIHSA
GADSGDGGPRLDVDYVPATVTDIFGASQDTLSTALQWLLVLFTRYSEVQARVQAELDQVV
GRHRLPTLEDQPRLPYVMAFLYEAMRFSSFVPVTIPHATTANASVLGYHIPKDTVVFVNQ
WSVNHDPVKWSNPEDFDPTRFLDKDGLINKDLTGSVMVFSVGKRRCIGEEISKMQLFLFI
SILAHQCNFKANPDEPSKMDFNYGLTIKPKSFKINVTLRESMELLDSAVQKLQVEKECQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggccactggcctcagcccggacgatcacctgtcgccgacccttctgtcggtccagcag
accatgctccttctgctgctctcggtgctggccgcagtgcacgtgggccagtggctgttg
aggcagcggcggcggcagccgggctccgcgccccccggtccctttgcttggccgctgatc
ggaaatgcggcgtcaatgggctcggcgccgcacctcttgttcgcacgtctggcgcggcgc
tacggcgacgtcttccagatccatctcggcagctgccgggtggtggtgctgaacggcgag
cgcgccatccgccaggcgctggtgcaccagagcgcggccttcgccgaccggccgcctttc
gcctctttccgcttggtgtccggtggccgcagcctggctttcggccagtactcggagagc
tggaaggcgcagcggcgcgcggcgcacagcacgatgcgagccttctccacgcgccagccg
cgcggccgccgggtcctcgagggccacgtggtaggcgaggtgcgggagttggtagagctg
ctggtgcgccgcagcgcgggcggcgccttcctagacccgcggccactgaccctggtggcc
gtggccaacgtcatgagcgctctgtgcttcggctgccgctacagccacgacgacgccgag
ttcctcgaattgctcagccacaacgaggagtttgggcgcactgtgggcgcgggcagcctg
gtggacgtgctgccctggctgcagcgcttccctaaccccgtgcgcactgccttccgtgaa
ttcgagcagctcaatcgcaacttcagcaacttcgttctagacaagttcctgaggcaccgc
gaaagcctccggcccggggccgccccccgcgacatgatggacgctttcatccactcggcg
ggggctgactctggcgatggtggcccgcgcctggacgtagactacgtgccggccacggtc
acagacatcttcggcgccagccaggatactctctccaccgcgctgcagtggctgctcgtt
ctcttcaccaggtattcggaagtgcaggcgcgggtacaggcagaactggatcaagtggtg
ggtaggcaccggctgcccaccctggaggaccagccccgcttgccctacgtcatggccttt
ctttatgaagccatgcgcttctccagctttgtgcctgtcaccattccgcacgccaccacg
gctaacgcttccgtcttgggctaccacatccccaaggacacggtggtgtttgttaaccag
tggtccgtgaatcatgatccggtgaagtggtcgaacccagaggactttgacccaacccga
ttcttggacaaggatggcctcatcaacaaggacttgacaggcagcgtgatggttttttct
gtgggcaaacggcggtgcatcggggaagagatttctaagatgcagctgtttctcttcatc
tccatccttgctcaccagtgcaatttcaaggccaatccagacgagccttcgaaaatggat
tttaattacggcctgaccattaaacccaagtcatttaaaatcaatgtgactctcagagag
tctatggagctccttgatagtgctgtccaaaagttacaagtggagaaagagtgccagtga

DBGET integrated database retrieval system