KEGG   Bos taurus (cow): 511498Help
Entry
511498            CDS       T01008                                 

Definition
cytochrome P450, family 2, subfamily c (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    511498
   00590 Arachidonic acid metabolism
    511498
   00591 Linoleic acid metabolism
    511498
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    511498
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    511498
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    511498
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    511498
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     511498
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   511498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 495 aa AA seqDB search
MERLEITTLALVICVTCLVFLFVWKKSHKGLGKLPPGPTPLPIIGNLMQLNLKDIPASLS
KLAKQYGPVYTLHLGSQTTVVLHGYEVVKEALIDQGDEFLGRAHFPIIDDTQRGYGLIFS
NGDTWKQMRRFSLMTLRNFGMGKRSLEERIQEEAQFLVEEFRKSEAQPFNPAVTLSCATC
NIICSILFNERFHYQDKTLHSLLDLLNENFNRISSLWNQIYNLWPKLIKPLPGEHRAFSK
RLKDVHYFVLEKVKEHQKSLNHNNPRDYIDCFLSRMEQEKQNPESQFHLENLATCGSNLF
SAGVETTTATLSYGLLLLMKYPEVQAKVHEEIDRVIGRTRSPCMKDKMKLPYTEAVLHEI
QRYVTLVPSNLPHAVVQDTKFRQYVIPKGTTVLPLLSSILYDCKEFPNPEKFDPGHFLDK
NGSFRKTKYFVAFSIGKRACVGEGLAQMELFLFFTTILQNFVLKPLGETKDIETKPIVIG
LINMPPPFKLCLIPR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggaacgactggaaatcactactcttgctcttgtgatttgtgtcacttgcctggttttt
ctttttgtgtggaagaaaagtcacaaaggtttgggaaagctccctcctggtccaactccc
cttcccatcattgggaatctgatgcaactaaacctcaaggacatccctgcatctctttcc
aagttggccaaacaatatggacctgtttacactctgcaccttggatcccagaccactgtg
gtcttacatggatatgaagtggtgaaggaagctctaattgaccaaggtgatgaattcctt
ggcagagcacattttcctattattgacgatacccagagaggatatggactcattttcagc
aatggagacacgtggaagcaaatgcggcgcttctcccttatgaccctaaggaactttggg
atggggaagaggagccttgaggagaggatccaagaggaggcccagtttctggtggaggag
ttcaggaaatcagaggctcagccctttaaccctgctgtcaccctgtcctgtgctacctgc
aacatcatctgctccatcctcttcaacgaacgtttccactaccaagataagacccttcac
tccctgctggatttgttaaatgaaaattttaatcgaataagctctctctggaaccagatt
tacaatctatggccaaaactcataaagcctctccctggagagcacagagcattttcaaaa
aggcttaaggatgttcactactttgttctggaaaaagtgaaggagcatcaaaagtccctg
aatcataataaccctcgagactacattgactgtttcctcagcaggatggagcaggagaaa
cagaacccagagtctcaatttcacttggaaaacttagcaacctgtggatcaaatctgttt
tcagcaggagtagagacaaccactgccaccctgagttacgggttgctgctcctaatgaaa
taccctgaggttcaagccaaagttcatgaagaaattgaccgtgtgattggacgcacccga
agtccctgcatgaaggacaagatgaagctgccctatacagaggctgtgttgcatgagata
caaagatacgtcaccctcgttccttctaacttaccccatgctgtggtccaggacacgaaa
ttcagacaatatgtcatccccaagggtactactgtattgccgttactgtcttccatcttg
tacgactgcaaggagtttcctaacccagagaagtttgacccaggccattttttggataaa
aatggcagcttcaggaaaacaaaatactttgtggctttttccattgggaaacgggcctgt
gttggagagggccttgcccaaatggagctgttcctgttcttcaccaccattctgcaaaat
tttgtcctgaaacccctgggggagacaaaggacatagagaccaaacccattgttattgga
ctgatcaacatgccaccacccttcaagctatgccttatccccagataa

DBGET integrated database retrieval system