KEGG   Bos taurus (cow): 511603Help
Entry
511603            CDS       T01008                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5 (EC:5.3.4.1)
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     511603 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
1
AA seq 521 aa AA seqDB search
MARVVPAWLLLPLAVWVVLPTWLSSAKFSSLIERISDPKDLKKLLRTRNNVLVLYSKSEA
AAESHLKLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSAKDKKVELFHYQDGAF
HTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDNEKDFRRLLKKEEKPILMMFY
APWCSVCKRIMPHFQKAATQLRGQFVLAGMNVYPSEFENIKEEYSVRGYPTICYFEKGRF
LFQYDSYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLSDEDFDQFVKEHSSVLV
MFHAPWCGHCKKMKPEFESAAEVLHGEGDSSGVLAAVDATVNKALAERFHIAEFPTLKYF
KNGEKYAVPALRTKKSFIEWMRNPESPPPPDPAWEEQQTSVLHLSGDNFRETLKRKKHAL
VMFYAPWCPHCKKAIPHFTAAADAFKDDRKIACAAIDCVKENNKDLCQQEAVKAYPTFHY
YHYGKFVEKYDTNPTELGFTSFIRTLREGDHERLGKKKEEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggtcgtgccggcgtggctgctcctgccgctggcagtctgggtggtcctgccg
acgtggctgtcctccgcaaagttctcctcactcatcgagagaatctctgaccccaaggac
ttgaaaaaacttctcaggacccggaataatgtactggtgctttactccaaatctgaagct
gcagctgaaagtcacctcaagttactgtctactgtcgcccaggcagtgaaaggacaaggc
accatctgctgggtggactgtggtgacgcagaaagtagaaaattgtgcaagaagatgaaa
gttgacctgagtgcaaaggacaaaaaggttgaattattccattaccaggatggtgcattt
catactgaatataaccgagctgtgacgtttaagtccatagtggcctttctgaaggatcca
aaagggcccccattgtgggaggaagatcctggagccaaagatgttgtccacattgacaat
gaaaaggacttccgtcggctcctgaagaaggaagagaagccgatcctgatgatgttttat
gctccatggtgcagcgtgtgcaagaggataatgccacacttccagaaggctgcaacccag
ctgcggggccagttcgtgctggccgggatgaatgtctacccctcggaatttgaaaacatc
aaggaggagtacagcgtgcgtggctaccccaccatctgctatttcgagaaaggacggttt
ctgttccagtatgacagctatgggtccacagctgaggacattgtggagtggctgaagaat
ccgcagccgccacagccccaggtccccgagactccctgggcagatgagggcggctccgtt
tatcacctgagcgatgaagactttgaccagtttgtgaaggaacactcctctgtgctcgtc
atgttccacgccccatggtgtggacactgtaagaaaatgaagccagagtttgagagtgca
gcagaagtcctccacggagaaggagatagctctggtgtccttgcagctgtcgatgccacc
gtcaacaaggccctggcagaacgattccacattgccgagtttcctacactcaaatatttt
aagaatggggagaagtatgcagtgcctgcgctcagaacaaagaagagcttcatcgagtgg
atgcgaaaccccgagtccccgccacccccagaccccgcctgggaagagcagcagaccagc
gtgttgcatctgtctggggacaacttccgggagaccctgaagcggaagaagcacgccttg
gtcatgttctacgccccatggtgcccgcactgtaagaaggccattccacactttactgcc
gctgctgatgccttcaaagatgaccgaaagattgcctgtgccgctattgactgcgtcaaa
gagaacaacaaggacttgtgtcagcaggaggctgtcaaggcctaccccactttccactac
taccactacgggaagtttgtggagaagtatgacaccaatccgacggagctgggatttacc
agttttatccgaacgctccgggagggagaccatgagagactaggaaagaagaaggaagag
ttgtaa

DBGET integrated database retrieval system