KEGG   Bos taurus (cow): 511976Help
Entry
511976            CDS       T01008                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:bta04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:bta04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:bta04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:bta04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:bta05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:bta05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:bta05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 1062 aa AA seqDB search
MSARPRRGPRVSRAPPLAPLCCFSAALGMLWSPASQAFNLDVDKLTVYSGPEGSYFGYAV
DFHIPAARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPAPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
FKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVAVSDVNNDGMDDILIGAPLFMEREFESSPREVGQVY
LYLQESALVFRDPQVLAGTEVFGRFGSAVAHLGDLNQDGYNDVAIGAPFAGKDQRGKVLI
YNGNKNGLNTKPSQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVGAQLLLQPVIINLENKTCLIPESVAPVACFSLKVCASVAGQNIANTIGLTAE
VQLDTLKQKGAIKRTLFLDNHQSHLIFPLVIKGQKSLQCQDFIVYLRDETEFRDKLSPIN
ISLNYSLDESTFQEGLEVKPILNYYRDNVVSEQAHILVDCGEDNMCIPDLKLSARPDKHQ
VIIGDENHIMLIINARNEGEGAYEAELFVIIPEEADYVGIERSNKALRPLSCEYKMDNVT
RMVVCDLGNPMVAGTNSSLGLRFTVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQINI
TAVAQVEIRGVSHPPQIVLPIQNWEPEEEPRKEEGVGPLVEHVYELHNIGPSTISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAAPREDTPELSAFLRNSTIPH
LVRRRDVPQLEPHRQSPAKILNCTNIECLQISCVVGRLGGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYKDQPAKLPEGNIAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDMNDREQLTNEKTPEA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccggccccgccgcggtccccgggtcagccgggcaccgccgctcgcgcccctc
tgctgcttctcggccgctctggggatgctgtggtcccccgcctcgcaggcgttcaacttg
gacgtggacaagctcacggtgtacagcggacccgaaggcagctacttcggctacgcggtg
gacttccacatacctgccgctcgcacggcgagtgtcttggtgggggcgcccaaagccaac
accagccagccagacatcgtggaagggggagcagtctactactgtccttggcccgccgag
gggtctgcgcagtgcaggcagataccatttgacaacaccaacaacagaaagataagagta
aatggaaccaaggaacctatagagtttaaatcgaatcagtggtttggagccacagtgaga
gctcacaaaggaaaggtggtggcttgtgctccattatatcactggagaactcttaaacca
gcaccagaaaaggacccagttggcacttgctatgtagccattcagaatttcagtgcatat
gctgagtactctccttgtcggaacagcaatgctgatcctgaaggccagggttactgccaa
gcaggatttagtctggatttttataagaatggagatcttatagttggaggccctggaagt
ttttattggcaaggtcaggtgatcacggccagtattgcagatatcattgcaaactactca
ttcaaggatatcctaaggaaattggctggagaaaagcagacagaagtggctccagcttcc
tacgatgacagttaccttggatattcagttgctgctggggaatttactggggactctcag
caagaattggttgctggagttccaagaggcgcacagaattttggatatgtttcaatcatt
aactctacagatatgacctttattcagaatttcactggtgaacagatggcatcttatttt
ggatatacagttgcagtatcagatgttaacaatgatgggatggatgacatactgattggg
gcacctctctttatggaacgtgaatttgagagcagccccagagaggtagggcaagtttat
ctgtatctgcaagagagcgccctcgtcttcagagacccgcaggtgctcgcaggcaccgag
gttttcgggagattcggcagtgctgtggcacatttaggagacctgaaccaagatggatac
aatgacgttgccattggtgcgccctttgcaggcaaggatcaaagaggaaaagtgctcatt
tacaacgggaacaagaatggcttaaacaccaagccttcccagattctgcaaggagtgtgg
gcctcccaggctgtcccttctggattcggctttactttaagaggagattcagacatagac
aagaatgattaccctgatttaattgtgggtgcatttggaacgggaaaagtagcagtttac
agagcgaggccggttgtgacggtgggggcccaacttctcctgcagccggtgatcatcaat
ctggaaaacaaaacctgcctgattccagaatcagtggcacctgtggcctgcttttcttta
aaagtgtgtgcatctgtggcaggccagaacattgcaaacacaataggcctgaccgctgag
gtgcagttagacaccctgaaacaaaaaggagccattaaacgtacactcttccttgataac
catcagtcacatctcatcttccctctcgtgataaaagggcagaaatccctccagtgccag
gattttatcgtttaccttcgagatgagactgaattccgagacaaattatctccaatcaac
attagtttgaattacagtttggatgaatccacttttcaagaaggtctggaggtgaaacca
atattgaactactacagagacaatgttgttagtgaacaggctcacatcctggttgactgc
ggagaagataacatgtgcattcctgacttgaagctgtcagctagaccagataagcaccag
gtcatcattggagatgaaaaccacattatgctcataatcaatgcgagaaatgaaggggaa
ggtgcctacgaagctgagctctttgtgatcattccagaagaggccgattatgttgggatt
gaacgcagcaataaggcactgcgcccactgagttgtgagtacaagatggacaatgtcacc
cgaatggtggtgtgtgaccttgggaaccctatggtggctggaacaaattcttctctgggc
ctccgatttacagttccacgtcttgagaaaacaaacatgagtattaacttcgatcttcaa
atcagaagttccaacaaggacaacccagacagcaattttgtgagcctgcaaatcaacatc
actgctgtagctcaagtagaaataagaggagtgtcccaccctccgcagatcgtcctgccc
attcagaactgggaaccagaagaggagcctcgcaaggaggagggagttggaccattggtg
gaacatgtttatgagctgcacaatattggaccaagcaccatcagcgacaccctcctggag
gtgggctggcccttctctgcccgggacgaatttctcctctacatttttcatattcaaact
ctgggacctctgcgatgtcaaacaaatcctgatatcaacccacaagatataaagccggct
gccccccgggaggacacccctgagctgagtgcatttttgcgaaactccaccatccctcat
ctggtcaggaggagagacgtgcctcaattggagcctcacagacagagccccgcaaagatc
ctgaattgcacaaacattgagtgcttacaaatctcctgtgtggtgggacgactaggagga
ggagaaagcgccgtcctgaaagtcaggtcacggctatgggccaagacatttctccagagg
aaaaatgatccctattctcttgcatccctggtgtcctttgaagttaagaagatgccttat
aaagatcagccagcaaaactcccagaaggcaacatagcaattaaaacatcggttatttgg
gccaccccaaatgtttccttctcaattccattatgggtaataatactagcaatacttctt
ggattattggttctggccattttaaccttggctttatggaagtgcggattctttgaccga
gcaagaccaccccaggacgatatgaatgaccgggaacagctgaccaatgagaaaacccct
gaggcatga

DBGET integrated database retrieval system