KEGG   Bos taurus (cow): 511976Help
Entry
511976            CDS       T01008                                 

Gene name
ITGA8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  integrin alpha 8
Organism
bta  Bos taurus (cow)
Pathway
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta04514  Cell adhesion molecules (CAMs)
bta04810  Regulation of actin cytoskeleton
bta05165  Human papillomavirus infection
bta05410  Hypertrophic cardiomyopathy (HCM)
bta05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
bta05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    511976 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    511976 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    511976 (ITGA8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    511976 (ITGA8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    511976 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    511976 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    511976 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    511976 (ITGA8)
  Infectious diseases
   05165 Human papillomavirus infection
    511976 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 511976
NCBI-ProteinID: XP_002692127
Ensembl: ENSBTAG00000007602
UniProt: E1BNM2
Position
13
AA seq 1062 aa AA seqDB search
MSARPRRGPRVSRAPPLAPLCCFSAALGMLWSPASQAFNLDVDKLTVYSGPEGSYFGYAV
DFHIPAARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPAPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
FKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVAVSDVNNDGMDDILIGAPLFMEREFESSPREVGQVY
LYLQESALVFRDPQVLAGTEVFGRFGSAVAHLGDLNQDGYNDVAIGAPFAGKDQRGKVLI
YNGNKNGLNTKPSQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVGAQLLLQPVIINLENKTCLIPESVAPVACFSLKVCASVAGQNIANTIGLTAE
VQLDTLKQKGAIKRTLFLDNHQSHLIFPLVIKGQKSLQCQDFIVYLRDETEFRDKLSPIN
ISLNYSLDESTFQEGLEVKPILNYYRDNVVSEQAHILVDCGEDNMCIPDLKLSARPDKHQ
VIIGDENHIMLIINARNEGEGAYEAELFVIIPEEADYVGIERSNKALRPLSCEYKMDNVT
RMVVCDLGNPMVAGTNSSLGLRFTVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQINI
TAVAQVEIRGVSHPPQIVLPIQNWEPEEEPRKEEGVGPLVEHVYELHNIGPSTISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAAPREDTPELSAFLRNSTIPH
LVRRRDVPQLEPHRQSPAKILNCTNIECLQISCVVGRLGGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYKDQPAKLPEGNIAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDMNDREQLTNEKTPEA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccggccccgccgcggtccccgggtcagccgggcaccgccgctcgcgcccctc
tgctgcttctcggccgctctggggatgctgtggtcccccgcctcgcaggcgttcaacttg
gacgtggacaagctcacggtgtacagcggacccgaaggcagctacttcggctacgcggtg
gacttccacatacctgccgctcgcacggcgagtgtcttggtgggggcgcccaaagccaac
accagccagccagacatcgtggaagggggagcagtctactactgtccttggcccgccgag
gggtctgcgcagtgcaggcagataccatttgacaacaccaacaacagaaagataagagta
aatggaaccaaggaacctatagagtttaaatcgaatcagtggtttggagccacagtgaga
gctcacaaaggaaaggtggtggcttgtgctccattatatcactggagaactcttaaacca
gcaccagaaaaggacccagttggcacttgctatgtagccattcagaatttcagtgcatat
gctgagtactctccttgtcggaacagcaatgctgatcctgaaggccagggttactgccaa
gcaggatttagtctggatttttataagaatggagatcttatagttggaggccctggaagt
ttttattggcaaggtcaggtgatcacggccagtattgcagatatcattgcaaactactca
ttcaaggatatcctaaggaaattggctggagaaaagcagacagaagtggctccagcttcc
tacgatgacagttaccttggatattcagttgctgctggggaatttactggggactctcag
caagaattggttgctggagttccaagaggcgcacagaattttggatatgtttcaatcatt
aactctacagatatgacctttattcagaatttcactggtgaacagatggcatcttatttt
ggatatacagttgcagtatcagatgttaacaatgatgggatggatgacatactgattggg
gcacctctctttatggaacgtgaatttgagagcagccccagagaggtagggcaagtttat
ctgtatctgcaagagagcgccctcgtcttcagagacccgcaggtgctcgcaggcaccgag
gttttcgggagattcggcagtgctgtggcacatttaggagacctgaaccaagatggatac
aatgacgttgccattggtgcgccctttgcaggcaaggatcaaagaggaaaagtgctcatt
tacaacgggaacaagaatggcttaaacaccaagccttcccagattctgcaaggagtgtgg
gcctcccaggctgtcccttctggattcggctttactttaagaggagattcagacatagac
aagaatgattaccctgatttaattgtgggtgcatttggaacgggaaaagtagcagtttac
agagcgaggccggttgtgacggtgggggcccaacttctcctgcagccggtgatcatcaat
ctggaaaacaaaacctgcctgattccagaatcagtggcacctgtggcctgcttttcttta
aaagtgtgtgcatctgtggcaggccagaacattgcaaacacaataggcctgaccgctgag
gtgcagttagacaccctgaaacaaaaaggagccattaaacgtacactcttccttgataac
catcagtcacatctcatcttccctctcgtgataaaagggcagaaatccctccagtgccag
gattttatcgtttaccttcgagatgagactgaattccgagacaaattatctccaatcaac
attagtttgaattacagtttggatgaatccacttttcaagaaggtctggaggtgaaacca
atattgaactactacagagacaatgttgttagtgaacaggctcacatcctggttgactgc
ggagaagataacatgtgcattcctgacttgaagctgtcagctagaccagataagcaccag
gtcatcattggagatgaaaaccacattatgctcataatcaatgcgagaaatgaaggggaa
ggtgcctacgaagctgagctctttgtgatcattccagaagaggccgattatgttgggatt
gaacgcagcaataaggcactgcgcccactgagttgtgagtacaagatggacaatgtcacc
cgaatggtggtgtgtgaccttgggaaccctatggtggctggaacaaattcttctctgggc
ctccgatttacagttccacgtcttgagaaaacaaacatgagtattaacttcgatcttcaa
atcagaagttccaacaaggacaacccagacagcaattttgtgagcctgcaaatcaacatc
actgctgtagctcaagtagaaataagaggagtgtcccaccctccgcagatcgtcctgccc
attcagaactgggaaccagaagaggagcctcgcaaggaggagggagttggaccattggtg
gaacatgtttatgagctgcacaatattggaccaagcaccatcagcgacaccctcctggag
gtgggctggcccttctctgcccgggacgaatttctcctctacatttttcatattcaaact
ctgggacctctgcgatgtcaaacaaatcctgatatcaacccacaagatataaagccggct
gccccccgggaggacacccctgagctgagtgcatttttgcgaaactccaccatccctcat
ctggtcaggaggagagacgtgcctcaattggagcctcacagacagagccccgcaaagatc
ctgaattgcacaaacattgagtgcttacaaatctcctgtgtggtgggacgactaggagga
ggagaaagcgccgtcctgaaagtcaggtcacggctatgggccaagacatttctccagagg
aaaaatgatccctattctcttgcatccctggtgtcctttgaagttaagaagatgccttat
aaagatcagccagcaaaactcccagaaggcaacatagcaattaaaacatcggttatttgg
gccaccccaaatgtttccttctcaattccattatgggtaataatactagcaatacttctt
ggattattggttctggccattttaaccttggctttatggaagtgcggattctttgaccga
gcaagaccaccccaggacgatatgaatgaccgggaacagctgaccaatgagaaaacccct
gaggcatga

DBGET integrated database retrieval system