KEGG   Bos taurus (cow): 512056Help
Entry
512056            CDS       T01008                                 

Gene name
RASGRP2, CalDAG-GEFI
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    512056 (RASGRP2)
   04015 Rap1 signaling pathway
    512056 (RASGRP2)
   04010 MAPK signaling pathway
    512056 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    512056 (RASGRP2)
   04062 Chemokine signaling pathway
    512056 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
29
AA seq 608 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSSSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IENVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPLELAAHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRAGVITHFVHVAEELLHLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLMVSLDQYQTEDELYQLSLQREPRSKSSPTSPTTCTPPPRPPVLEEWTSAAKPKLDQ
AIMVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISKEEM
VSYFLRSSSMLGGRMGFVHNFHESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSMSLEGSAPSPSPTHTHHRAFSFSLPRPGRRGSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaccctggacctggacaagggctgcacggtggaggagctgctccgtggttgc
atcgaagcctttgatgattccgggaaggtgcgggacccgcagctggtgcgcatgttcctt
atgatgcacccctggtacatcccttcctctcagctggcggccaaactgctccacatctac
caacaatcccggaaggacaactccagctcactgcaggtgaaaacatgccacctggtcagg
tactggatctcagcattcccagcggagtttgacttgaatcctgagcttgctgagcagatc
aaggagctgaaggctctgctagatcaagaagggaatcgccggcacagcagcctcatcgac
attgagaacgtccccacctacaagtggaagcggcaggtgacccagcggaaccccgtggaa
cagaagaagcgcaagatgtccctgctgtttgaccacctggagcccttggagctggcggca
catctcacctacttggaatatcgctccttctgcaagatcctgttccaggactatcacagt
tttgtgactcacggctgcacggtggacaatcccgtcctggagcgattcatctccctcttc
aacagtgtctcacagtgggtgcagctgatgattctcagcaagcccacagccccgcagcgg
gcgggggtcatcacacacttcgtccacgtggcagaggaactcctgcacctgcagaatttc
aacacgctgatggcagtggttgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgtgagcccggagaccatcaagctctgggaaggtctgacagagctggtg
acggccaccggcaactatggcaactaccggcgccggctggcggcctgcgtgggtttccgc
ttccccatcctgggtgttcacctcaaggacctggtggccctgcagctggcgctgccggat
tggctggaccccgcccggacccgactcaatggggccaagatgaagcagctcttcagtatc
ctggaggagctggccatggtgaccagcctccggcccccggtgcaagccaaccctgacctg
ctgagcctgctgatggtgtctttggatcaatatcagacagaggatgagctctaccagctg
tccctgcagcgggaaccgcgttctaagtcctcgccaaccagccccaccacctgcacaccg
cctccccggcccccggtgctggaggagtggacctcggctgccaaacccaagctggatcag
gcgatcatggtggagcacattgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggacggccacatctcacaggaggagttccagatcatccgtgggaattttccttat
ctcagcgcctttggggacctcgaccagaaccaggacggctgcatcagcaaggaggagatg
gtctcctactttctgcgctccagctctatgctgggcggccgcatgggcttcgtacacaac
ttccacgagagcaactccttgcgcccggtcgcctgccgccactgcaaggccctgatcctg
ggcatctacaaacagggtctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgccggcgccgggcccagagtatgagtctggaggggtct
gcaccctctccctcgcccacacatacccaccatcgcgccttcagcttctccctgccccgc
cctggcagacgaggctcccggcctccagagatccgagaggaggaggttcagacggtggag
gacggcgtgtttgacatccacttgtaa

DBGET integrated database retrieval system