KEGG   Bos taurus (cow): 512098Help
Entry
512098            CDS       T01008                                 

Gene name
CES1, CES
Definition
carboxylesterase 1 (monocyte/macrophage serine esterase 1) (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
bta  Bos taurus (cow)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    512098 (CES1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     512098 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 558 aa AA seqDB search
MWLLALVLTSLGSFTAWGLAPSPPIVDTAQGRVLGKHVSLKGFAQPVAVFLGVPFAKPPL
GSLRFAPPQPAEPWTFVKNTISYPPMCSQDPVGAQLLSDLFTNRKENISLTFSEDCLYLN
IYTPADLTKRSRLPVMVWIHGGGLMVGGASTYDGLVLSAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGAESVSILVLSPLARNLF
HRAISESGVALISTLVKRDSKAAAEQIAVIAGCKTTTSAVLVHCLRQKTEDELLEITLKM
KFFALDLHKDSTESHPFLPTVVDGMLLPKMPEEMLAEKNFNNVPYMVGINKQEFGWIIPL
FMSYPLPEDKLDQKTATSLLWQSYSLLSIPEELSPVATDKYLGGTDDPVKKKDLFLDLIA
DVLFGVPSVNVARRHRDAGAPTYMYEFQYRPSFSSELKPKTVIGDHGDELFSVFGAPFLK
DGASEEEINLSKMVMKFWANFARNGNPNGEGLPHWPAYDHKEGYLQIGVNTRAAEKLKDK
EVAFWNELLSREVARHHT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttagctctggtcctgacctcccttggttccttcacagcttgggggctggca
ccctcaccgcctattgtggacaccgctcagggcagagtcctggggaaacatgtcagctta
aaaggatttgctcagcctgtggccgtcttcctgggagtcccttttgccaagcctcctctt
ggatccttgaggtttgctccgccgcagcctgcagaaccatggacctttgtgaagaatacc
atctcttaccctcccatgtgctcccaagacccagtgggggcacagttgctctcagatctc
tttaccaacagaaaggagaacattagtctcacgttttccgaagactgtctttacctaaat
atatacacccctgctgacttgacgaagagaagcaggctgccggtgatggtgtggatccac
ggaggaggtctcatggtgggcggggcatcaacatatgatgggctggtcctctctgcccat
gaaaacgtggtggtggtgaccattcagtaccgcctgggcatctggggattcttcagcaca
ggggacgagcacagtcgggggaactggggccacttggaccaggtggccgcgctgcactgg
gtccaggagaacattgccaactttggaggggatccaggctctgtgaccatctttggagag
tcagcaggagcagaaagtgtctccattcttgtgttatcccccctggccaggaatctcttc
caccgggccatctctgagagcggcgtggccctcatttccaccctggtcaagagggactcg
aaggctgcagctgagcaaattgctgtcattgctggctgtaaaaccaccacctcagctgtc
cttgttcactgcctgcgccagaagacagaggacgagctcctggagataacactgaaaatg
aaatttttcgctcttgatttacacaaagactccacagagagccatcctttcctgcccacc
gtggttgacggaatgctgctgccaaagatgcccgaagagatgctggctgaaaagaatttc
aacaatgttccctacatggtgggaatcaacaagcaagagtttggctggattattccactg
ttcatgagctaccctctgcctgaagacaagctggaccagaagacggccacatcactcctg
tggcagtcctactctctccttagcattcctgaggaactgagtccagtggccactgacaag
tatttaggagggacagacgaccctgtcaaaaagaaagacctgttcctggacttgatagca
gacgtgctatttggcgtcccatctgtgaatgtggcccgtcgccacagagatgcgggagcc
cccacctacatgtatgagtttcagtatcgcccaagcttctcatcggagctgaaacccaag
acggtgataggggaccatggggatgagctcttctctgtcttcggggctccatttttaaaa
gatggtgcctcagaagaggagatcaatcttagcaagatggtgatgaaattctgggccaac
tttgctcggaatgggaaccctaatggggagggccttccccattggccagcgtatgaccac
aaagaagggtaccttcagattggtgtcaacactcgggccgctgagaagctgaaagacaag
gaagtagctttctggaatgagcttctgtccagggaggtggcaaggcaccacacttaa

DBGET integrated database retrieval system