KEGG   Bos taurus (cow): 512341Help
Entry
512341            CDS       T01008                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bta  Bos taurus (cow)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    512341 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    512341 (MLYCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    512341 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    512341 (MLYCD)
Enzymes [BR:bta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     512341 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 499 aa AA seqDB search
MRVLGPGLSAGRLLRLRLPPRQPQPPGPRLSSGRPAAAGALERAMDELLHRAVPAMPAYE
LREKTPARAENQCADFVSFYGGLAETAERAELLGRLARGFGVDHSQVAEQSAGVLQLRQQ
PREAAVLLQAEDRLRYALVPRYRSLFHHISKMEGGVRFLVRLRADLLEAQALKLVDGPHV
REMNGVLKNMLSEWFSSGFLNLERVTWHSPCEVLQRISEAEAVHPVKTWMDMKRRVGPYR
RCYFFSHCSTPGEPLIVLHVALTSEISSSIQTIIVKECPPSETEERNKITTAIFYSLSLT
QQGLQGVELGAFLIKRVVKELQKEFPALGAFSSLSPIPGFTKWLLGLLKSKAKEHGRSGL
LTDSESQEIAELTGGPALETLQTLLSSSEWAQSEQLARALQAPLMRLCAWYLYGEKHRGY
ALNPVAHFHLQNGAVLWRINWLADVSLKGVTGACGLMVNYRYFLEDTAANSTAYLGSKSI
KASEQVLSLVAQFQKNSKL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcctcgggccaggcttgtctgccgggcgcctcctccggctgcggctacccccg
cggcagccgcagccgccaggaccccggctgtcgagcgggcggccggcggcggccggcgcc
ctggagcgggccatggacgagctgctgcaccgcgccgtgcccgcgatgccggcctatgag
ctgcgcgagaagaccccggcgagggcggagaaccagtgcgcagactttgtgagcttctac
ggcggcctggccgagacagccgagcgcgccgagctactgggccgcctggcgcgcggcttc
ggcgtggaccacagccaggtggccgagcagagcgccggtgtgctccagctgcgccagcag
ccgcgggaggcagccgtgctgctgcaggccgaggaccggctgcgctacgcgctagtgccg
cgctaccgcagcctcttccaccacatcagcaagatggagggcggcgtgcgcttcctggtg
cggctgcgggccgacctgctcgaggcgcaagccctcaagctagtggacgggccgcacgtc
cgggaaatgaacggggtgctgaaaaacatgctctcagagtggttttcctcggggttcctg
aacctggagcgggtcacctggcattccccgtgcgaagtgctccagagaatcagcgaggct
gaggccgtgcaccccgtgaaaacctggatggacatgaagcgacgcgtggggccctatcgg
aggtgctacttcttctctcactgctcgacgccaggggaacccctgatcgtcctgcatgtg
gccctgaccagcgagatctccagcagcatccagacgatcatagtaaaggagtgcccccca
tcagagacggaggagcggaacaagatcaccacggccatcttctactcgctgagcctaacc
cagcaggggctgcagggcgtggagctgggcgccttcctcatcaagcgggtggtgaaggag
ctgcagaaggagttccccgcgctgggcgccttctccagcctgtctcccatccccggcttc
accaagtggctcctggggctactcaagtccaaagccaaggagcacgggcggagcggactg
ttgacggactccgagagtcaggagatcgccgagctcacgggcggccccgcgcttgaaacg
ctgcagacgctgctgagcagcagcgagtgggcgcagtcggagcagctggcgcgggcactg
caagccccgctgatgcggctgtgcgcctggtacctgtacggggagaagcaccggggctac
gcgctcaaccccgtggcccacttccacctgcagaacggggccgtgctctggcgcatcaac
tggctggccgacgtcagcctcaagggcgtcacgggcgcctgcggcctgatggtcaactac
cgctacttcctagaggacacggccgccaacagcaccgcctacctcggctccaagagcatc
aaggcctccgagcaggtcctcagcctggtggcgcagttccagaagaacagcaaactctag

DBGET integrated database retrieval system