KEGG   Bos taurus (cow): 512355Help
Entry
512355            CDS       T01008                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04064  NF-kappa B signaling pathway
bta04071  Sphingolipid signaling pathway
bta04141  Protein processing in endoplasmic reticulum
bta04210  Apoptosis
bta04217  Necroptosis
bta04380  Osteoclast differentiation
bta04621  NOD-like receptor signaling pathway
bta04622  RIG-I-like receptor signaling pathway
bta04657  IL-17 signaling pathway
bta04668  TNF signaling pathway
bta04920  Adipocytokine signaling pathway
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05160  Hepatitis C
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    512355 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    512355 (TRAF2)
   04064 NF-kappa B signaling pathway
    512355 (TRAF2)
   04668 TNF signaling pathway
    512355 (TRAF2)
   04071 Sphingolipid signaling pathway
    512355 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    512355 (TRAF2)
   04217 Necroptosis
    512355 (TRAF2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    512355 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    512355 (TRAF2)
   04657 IL-17 signaling pathway
    512355 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    512355 (TRAF2)
  Development
   04380 Osteoclast differentiation
    512355 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    512355 (TRAF2)
   05203 Viral carcinogenesis
    512355 (TRAF2)
   05222 Small cell lung cancer
    512355 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    512355 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    512355 (TRAF2)
   05168 Herpes simplex infection
    512355 (TRAF2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    512355 (TRAF2)
   05169 Epstein-Barr virus infection
    512355 (TRAF2)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     512355 (TRAF2)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     512355 (TRAF2)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    512355 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4 Reo_sigmaC
Motif
Other DBs
NCBI-GeneID: 512355
NCBI-ProteinID: XP_002691752
BGD-bta: BT11449
Ensembl: ENSBTAG00000010497
Position
11
AA seq 516 aa AA seqDB search
MAAASVTPPGSLDLLQPGFSKTLLGTKLEDKYLCSACKNVLRRPFQAQCGHRYCSFCLSS
ILSSGPQSCAACVHEGIYEEGVSILESSSAFPDNAARREVESLPAVCPSEGCSWKGTLKD
YESCHEGQCPFMLTECPACKGLVRLGEKEHHLEHQCPERSLSCRHCRAPCSPADMKAHHQ
ICPKFPLTCDGCGKKKIAREKFQDHVRACGRCRVPCRFHAVGCPEMVESEQQPEHEAQRL
QEHLALLLGVLLEAGRPPGDSRLLLRPGEGALEAGTPSRVAELLQRCEALERKTATFENI
VCVLNREVERVAVTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVLEM
EASTFDGVFIWKISDFSRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRAYLNGDGTGRGT
HLSLFFVLMRGPHDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVGDMNI
ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccagcgtgacccctcccggctccctggacctactgcagcccggcttctcc
aagactctcctggggaccaagctagaggacaagtacctgtgctcggcctgcaagaacgtg
ctgcgcagacccttccaggctcagtgtggccatcgctactgctccttctgcctgagcagc
atcctgagctccgggccccagagctgcgccgcctgcgtgcacgagggcatttacgaggag
ggcgtctcaatcctggagagcagctcggcgtttccggacaatgctgcccgcagggaggtg
gagagcctgccggccgtctgccccagcgagggctgctcctggaaggggaccctgaaggac
tacgagagctgccacgaaggacagtgcccattcatgctgaccgagtgcccggcgtgcaaa
ggcctcgtgcgcctgggcgagaaggagcaccacctggagcaccagtgcccggagcggagc
ctcagctgccggcactgcagggcgccctgctcccctgccgacatgaaggcgcaccaccag
atctgccccaagttccccttgacgtgcgacggctgcggcaagaagaagatcgcccgtgag
aagtttcaggaccacgtccgggcgtgtggcagatgccgagtcccatgccgattccacgct
gttggctgccccgagatggtggagagcgagcagcagccggagcacgaggcgcagcggctc
caggagcacctggccctgctgctgggcgtcctgctggaggctgggcggcccccgggggac
agccgcctgctcctcaggccaggcgagggcgccttggaggccggcacaccctccagggtg
gcggagctgctgcagaggtgcgaggccctggagcggaagacagccaccttcgagaacatc
gtctgtgtgctgaaccgggaggtggagcgggtggccgtgacggctgaggcctgcggccgg
cagcaccggctggaccaagacaggatcgaggccctgagcaacaaggtgcagcagctggag
aggagcatcggcctgaaggacctggccatggccgacctggagcagaaggtcctcgagatg
gaggcgtccacctttgacggcgtgttcatctggaagatctcggacttctccaggaagcgc
caggaagccgtggccggccgcacgcccgccatcttctccccagccttctacaccagcagg
tacggctacaagatgtgcctgcgcgcctacctcaacggggacggcacggggcgcggcacg
cacctgtccctcttcttcgtgctaatgcgtggcccgcacgacgccctcctgcgctggccc
ttcaaccagaaggtgaccctgatgctgctggaccagaacaaccgggagcatgtgatcgac
gccttcaggcccgacgtgacctcgtcctccttccagaggccggtcggcgacatgaacatc
gccagcggctgcccgctcttctgccctgtctccaagatggaggccaagaactcctacgtg
cgtgacgacgccatcttcatcaaggccatcgtggacctgaccgggctctag

DBGET integrated database retrieval system