KEGG   Bos taurus (cow): 512662Help
Entry
512662            CDS       T01008                                 

Gene name
CHP1, CHP
Definition
(RefSeq) calcineurin like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
bta  Bos taurus (cow)
Brite
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     512662 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 512662
NCBI-ProteinID: NP_001069044
BGD-bta: BT24713
Ensembl: ENSBTAG00000027173
UniProt: Q3SYS6
Position
10
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggaa
actggcttttctcacagtcagatcacccgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagactttcagcggattccagaacttgccatcaac
ccattgggggaccggatcatcaacgccttctttccagagggagaggaccaggtaaacttc
cggggattcatgagaaccttggctcatttccgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctgtatgacttggataaagatgacaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtgaatatctcagatgagcagctgggcagcattgcagacaggaccatc
caggaggctgatcaggatggggacagcgccatctctttcacagaatttgttaaggttttg
gagaaggtggacgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system