KEGG   Bos taurus (cow): 512737Help
Entry
512737            CDS       T01008                                 

Gene name
CLK2
Definition
CDC-like kinase 2 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     512737 (CLK2)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   512737 (CLK2)
Spliceosome [BR:bta03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    512737 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 499 aa AA seqDB search
MPHPRRYHSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRAYDRRYCGSYRRNDYSRDRGEAYYDTDYRHSYEYHRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCV
DHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCI
SFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNS
DYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQP
CDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDW
DENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFAR
LRAEPPNAKLWDSSRDISR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatcctcgaaggtaccactcttctgagagaggcagcagagggagttaccacgag
cattatcggagccgaaagcataagcgacgaagaagccgctcctggtcaagcagcagtgac
cgtacgcggcggcgccgacgggaagacagttaccatgtccgttcccgaagcagctatgat
gatcgttcatccgatcggagggcgtatgaccggcgatactgtggcagctacaggcgcaac
gactacagccgagatcggggagaagcctactatgacacagactaccggcattcctatgag
taccatcgggagaacagcagttaccgcagccagcgcagcagccgtaggaagcaccgacgg
cggagacggcgcagccggacattcagccgttcgtcttcgcacagcagccggagagccaag
agtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaagag
cgatatgaaattgtaagcaccttgggagaggggaccttcggccgagttgtacagtgtgtt
gaccatcgcaggggtggggctcgggttgccctgaagatcattaaaaatgtggaaaagtac
aaggaagcagctcgcctagaaatcaatgtgctggagaaaatcaatgagaaggaccctgac
aacaagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgtatc
tcctttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctgccc
taccccatccaccaagtgcgccacatggccttccagctgtgccaggccgtcaagttcctc
catgataacaagctgacacatacggacctcaagcctgaaaatattctgtttgtgaattcg
gactatgagctcacctacaacctagagaagaagcgggatgagcgcagtgtgaagagcaca
gctgtgcgggtagtagactttggcagtgccaccttcgaccatgagcaccatagtaccatt
gtctccacccgccattatcgagcgccagaggtcattcttgagttgggctggtctcagcct
tgtgatgtgtggagtataggctgtatcatcttcgaatactatgttggcttcaccctcttc
caaacccatgacaacagagagcatctagccatgatggaaaggatcttgggtcccatccct
tcccggatgatccgaaagacaaggaagcagaaatatttttatcggggtcgcctggattgg
gatgagaacacatcagctgggcgctacgttcgagaaaactgcaaaccacttcggcggtat
ttgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgctagag
tatgaacctgccaagcggctgaccttgggcgaagcccttcaacaccctttcttcgcccgc
cttcgggctgagccacctaacgccaagttatgggactccagtcgagatatcagtcggtga

DBGET integrated database retrieval system