KEGG   Bos taurus (cow): 513080Help
Entry
513080            CDS       T01008                                 

Gene name
RAE1
Definition
RAE1 RNA export 1 homolog (S. pombe)
Orthology
K14298  
mRNA export factor
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    513080 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    513080 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 368 aa AA seqDB search
MSLFGTTSGFGSGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTVHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcgggttttggatctggtgggaccagcatgtttggcagc
acaaccacagataatcacaaccctatgaaggatattgaagtaacatcctctcctgatgat
agcattggttgtctatcatttagccccccaaccttgccgggaaactttcttattgcagga
tcgtgggctaatgatgttcgatgctgggaagttcaagatagcggacagactattccaaaa
gcccagcagatgcacacgggacctgtcctagatgtctgctggagtgatgatgggagcaaa
gtatttacagcctcatgtgataaaactgctaaaatgtgggacctcaatagtaaccaggcg
atacagattgcacagcacgatgctcctgtcaaaacagtacattggatcaaagcaccaaac
tacagctgtgtgatgactgggagctgggataagaccttgaagttttgggatacacgatca
tcaaatcctatgatggtgttacagctccctgaaaggtgttactgtgctgacgtgatatat
cctatggctgtggtggcaactgcagagaggggcctgattgtgtatcagttagagaatcag
ccttctgaattcaggaggatagagtctccactgaagcatcagcatcgatgtgtggctatt
tttaaagacaaacagaacaagccgacaggttttgccctgggaagcatcgaggggagagtt
gctatccactacatcaaccccccaaatcctgccaaggataacttcacctttaaatgtcat
cgatctaacgggaccaacacttctgctcctcaggacatctatgcggttaatggaattgcg
ttccatcctgtccatggcacccttgccactgtgggatctgatggtagattcagcttttgg
gacaaggatgccagaacaaaactaaagacttcggaacagttagatcagccgatatcggcc
tgctgcttcaatcacaatggaaacatatttgcgtatgcttccagctacgactggtcaaag
ggacatgaattttataatccccaaaagaaaaattacattttcctgcgtaatgcagctgaa
gagctaaaaccaaggaataagaagtag

DBGET integrated database retrieval system