KEGG   Bos taurus (cow): 513080Help
Entry
513080            CDS       T01008                                 

Gene name
RAE1
Definition
(RefSeq) ribonucleic acid export 1
  KO
K14298  mRNA export factor
Organism
bta  Bos taurus (cow)
Pathway
bta03013  RNA transport
bta05164  Influenza A
Module
bta_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    513080 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    513080 (RAE1)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     513080 (RAE1)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    513080 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 513080
NCBI-ProteinID: NP_001015585
BGD-bta: BT22625
Ensembl: ENSBTAG00000010934
UniProt: Q5E9A4
Position
13
AA seq 368 aa AA seqDB search
MSLFGTTSGFGSGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTVHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcgggttttggatctggtgggaccagcatgtttggcagc
acaaccacagataatcacaaccctatgaaggatattgaagtaacatcctctcctgatgat
agcattggttgtctatcatttagccccccaaccttgccgggaaactttcttattgcagga
tcgtgggctaatgatgttcgatgctgggaagttcaagatagcggacagactattccaaaa
gcccagcagatgcacacgggacctgtcctagatgtctgctggagtgatgatgggagcaaa
gtatttacagcctcatgtgataaaactgctaaaatgtgggacctcaatagtaaccaggcg
atacagattgcacagcacgatgctcctgtcaaaacagtacattggatcaaagcaccaaac
tacagctgtgtgatgactgggagctgggataagaccttgaagttttgggatacacgatca
tcaaatcctatgatggtgttacagctccctgaaaggtgttactgtgctgacgtgatatat
cctatggctgtggtggcaactgcagagaggggcctgattgtgtatcagttagagaatcag
ccttctgaattcaggaggatagagtctccactgaagcatcagcatcgatgtgtggctatt
tttaaagacaaacagaacaagccgacaggttttgccctgggaagcatcgaggggagagtt
gctatccactacatcaaccccccaaatcctgccaaggataacttcacctttaaatgtcat
cgatctaacgggaccaacacttctgctcctcaggacatctatgcggttaatggaattgcg
ttccatcctgtccatggcacccttgccactgtgggatctgatggtagattcagcttttgg
gacaaggatgccagaacaaaactaaagacttcggaacagttagatcagccgatatcggcc
tgctgcttcaatcacaatggaaacatatttgcgtatgcttccagctacgactggtcaaag
ggacatgaattttataatccccaaaagaaaaattacattttcctgcgtaatgcagctgaa
gagctaaaaccaaggaataagaagtag

DBGET integrated database retrieval system