KEGG   Bos taurus (cow): 513112Help
Entry
513112            CDS       T01008                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     513112 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
18
AA seq 570 aa AA seqDB search
MGTVVRTGSRALVGVACLLLAFSATDTGPGVTQPEVDTPLGRVRGRQVGVKGTDHLVNVF
LGIPFAQPPLGPHRFSAPRPAESWEGVRDASRAHAVCPQDPERMNNSRFTLDGKHQTFPI
SEDCLILNIYSPAEAPSGAGRPVMVWFHGGSLVTGTATSHDGSALAAYGDVVVVTVQYRL
GFLGFFSTGDKHAPGNWGFLDVVAALRWVQGNITPFGGDFNSVTIFGESSGASVVSALVL
SPLAAGLFHRAIAQSGIITVPGLLDPNPWLLAQTLADSLACNSDSSAEMVQCLRQKTIKE
MILAYKSKKIASYNIDGTFFPKSAEELLRERQFPSVPFLFGFNNHEFGWLIPRGWGFLDK
MDQLSLEDMLAILRPSLTNMDVPTEVMPTIIKEYLGSSSDGQAKREALQELLSDIIITLP
MLQFARDLQDSGVSIFFYEFQHRPSSFAKIKPAWVQADHAAELTFMFGGPFLTDESSMLA
FPEATEEEKQLSLTMMAQWTNFAWTGDPNGKGLPLWPPFNHAEEYLEISLVPRVNQKPRE
ARMQLWAEILPTKFGQWQQKQKGKKVQEEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggcacagtggtaagaaccgggtccagggccctggtcggggtggcctgtctgctcctg
gcattctctgctacagacactgggccgggggtcactcagcctgaagtggacacacccctg
ggccgtgtgcgaggccggcaggtgggcgtgaagggcacagaccatcttgtgaacgtcttc
ttgggcatcccattcgcccagccgcccctggggccccaccggttctcggccccgcgccca
gcggagtcttgggagggcgtgcgagatgccagcagggcccacgccgtgtgcccacaggat
ccggagagaatgaacaacagcagatttacgctggacggaaagcaccagaccttccccatt
tcggaggactgcctgatcctcaacatatacagcccggctgaggccccctcgggggcagga
aggccagtcatggtgtggttccacgggggctctctcgtgactggcaccgccacctcccac
gatgggtctgccctggccgcctatggggacgtggtcgtggtcacagtccagtaccgcctg
ggcttccttggctttttcagcactggggacaagcacgctcctggcaactggggcttcctc
gacgtcgtggctgctctgcgctgggtgcaggggaacatcaccccctttgggggtgacttc
aactctgtcaccatctttggtgaatctagcggggcctctgtcgtctctgccctggtcctg
tccccgctggctgcagggctgttccacagagctatagcacagagtggaatcatcaccgta
ccggggttactggatcctaacccctggctcctggctcagaccctcgcagactccttggcc
tgcaactctgactcctcggctgagatggtgcagtgccttcggcagaagacgatcaaggag
atgatcctcgcctacaagtcgaaaaaaatagcttcgtacaacatcgacggcaccttcttt
cccaagagcgctgaggagctcctgagggagaggcagttcccctctgtgcccttcctcttc
ggtttcaacaaccatgagtttggctggctcatccccaggggctggggtttcctggataag
atggatcaactgagcctggaggacatgctggccatcctgaggccctccttgaccaatatg
gatgtgcccactgaggtgatgcccaccatcataaaggaatacctaggcagcagctcagat
ggacaagccaagcgagaggccctccaggaattgttaagtgacattatcataaccttaccc
atgttgcaatttgcgagagacctccaagattctggtgtctccatctttttctatgagttc
cagcatcgacccagttcttttgcgaagatcaagccagcctgggtgcaggctgatcatgcg
gctgagttgaccttcatgttcggcggtcctttcctcacggatgagagctccatgttggcc
tttccagaagccacagaggaggagaagcaactgagcctcaccatgatggcccagtggacc
aactttgcctggacaggggaccccaatggcaaggggctgcctctttggccaccgttcaac
catgcggaggaatacctggaaatcagcctggtgccacgggtcaaccagaagccaagggag
gccagaatgcagctctgggcagagatacttcccaccaagtttgggcagtggcagcagaag
cagaagggcaagaaggtccaggaggaactctga

DBGET integrated database retrieval system