KEGG   Bos taurus (cow): 513276Help
Entry
513276            CDS       T01008                                 

Gene name
RBKS
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bta  Bos taurus (cow)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    513276 (RBKS)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     513276 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 325 aa AA seqDB search
MAASGDPGRQWQEEEAETAAAVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGAN
QCVQAARLGAKTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGAASIIVDNEG
QNIIVIVAGANLLLNTEDLREAASAISRAKVMICQLEVTPATSLEALRIAHSNGVKTLFN
PAPAIADLDPEFYTLSDVFCCNESEAEILTGLEVCSPTDAGRAALVLLERGCQVVIITLG
AEGCVMLSQTEPVPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYSHLSLEEMLKRSNFI
AAVSVQVTGTQSSYPYKKDLPLDLF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtctggggaccctgggaggcagtggcaggaggaggaggcggagacggcggcg
gcggtggtggtgggttcctgcatgaccgacctggtcagccttacttctcgtctgccaaaa
actggagaaaccatccatggacataagttttttattggctttggagggaaaggtgccaac
cagtgtgtccaagctgctaggcttggagcaaagacatccatggtgtgcaaggttggcaaa
gattcctttggcaatgattatatagaaaacttaaaacagaatgatatttctacagaattt
acatatcagactaaagatgctgcgaccggagctgcttctatcattgtcgataatgaaggc
cagaatatcatcgttatagtagctggagcaaatttacttttgaatacagaagacctgagg
gaagcagccagtgccatcagcagagccaaagtgatgatctgccagctagaagtaactcct
gcaacttctttggaagccctgagaatagcccacagcaatggagtgaaaacattgttcaat
ccggcgcctgccattgctgacctggaccccgaattctacaccctctcggatgtgttctgc
tgcaatgaaagtgaggctgagattctgaccggccttgaggtctgcagccccacagatgct
gggagggctgcgttggtgctcctggaaaggggctgccaggttgtaatcatcaccttgggt
gctgaaggatgtgtgatgctgtcacagacagaacctgtcccaaagcacattcccacagag
aaggtcaaggctgtggatactacgggtgctggtgacagttttgtgggagctttggccttc
tacctggcttactactcacatctatccttggaagaaatgctcaagagatctaatttcatc
gcagcggtcagtgtccaggtcacaggaacacagtcatcttatccatacaaaaaagacctg
ccccttgatctgttttga

DBGET integrated database retrieval system