KEGG   Bos taurus (cow): 513377Help
Entry
513377            CDS       T01008                                 

Gene name
ARHGEF1
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 1
  KO
K12330  
Rho guanine nucleotide exchange factor 1
Organism
bta  Bos taurus (cow)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    513377 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    513377 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    513377 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    513377 (ARHGEF1)
   05205 Proteoglycans in cancer
    513377 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
18
AA seq 971 aa AA seqDB search
MEAEDVARGAAPGPPRPGLAPVSIIGAEDEDFEIELKTNPEEQNNQFQNLDQVKRRPAHL
MALLQHVAMQFEPGPLLCCLHADMLGSLGPKEFKKAFIDFYHSFLDKHSILRVMVPPAVA
FELDRTRPDLFPEDLQRQFVQEVVQSQQVAVVRQLEDFRSKKLMGMTPWEQELVQLGAWV
ARDRASYEARERHLAERQLTHLEEMQHTISNDEEKSAAVVNAISMYMRHLGVRTKSGDKK
SGRNFFRKKMIGNRRSDEPTKTKKGLSSFLDAARWNRGEPQDFRHPKVEVDAEKPGLTER
KGGQGAPSRDRNLGGPGQDTPGVSPHLLSGDSPDREPGVDALLEVGDPPPQGPASLDAPA
PLESTEEAADTERKWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPS
SATAVLGPTRRATPEPGDEGEPGRSGLELEPEEPPGWRELVPQDILHSLPKSQVKRQEVI
SELLVTEAAHVRMLRVLHDVFYQPIADGGFYSQEELQNIFPSLDELIEVHSLFLDSLMKR
RQDSGYLIKEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCTFVQ
EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIEQNTEEPVEREKVERAAECCREILQH
VNLAVRDMEDLLRLKDYQRRLDLTHLRQSNDPMLSEFKNLDITKKRLIYEGPLTWRVTKD
KAVEVHVLLLDDLLLLLQRQDERFLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD
HKAFYVIFTWDQEAQIYELVAQTVSERRIWCTLITETAGCLKVPSRTSRPKHRPGPSSTR
EPLLSSSENGNGSREMPPADGRMERLFNSLLPFCRQGLEGQLAAKALQKVLTLKQLLLPS
EEDSGAGPPLEGDGVPGGSPLSPTQPQEIREELLSLEETIKQLEEVEEEFCRLRLLLSQL
GENTVPQSGCT
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaagacgtcgcccgaggggcggccccggggcccccccgacccggcctggcg
cccgtcagcatcattggggcagaggacgaggattttgagattgagttgaagacgaaccct
gaggaacaaaacaaccagttccagaacctggatcaggtgaagcggcgcccggcccacctc
atggccctcctgcagcacgtggccatgcagtttgagccgggacccctgctctgctgcctg
catgcggacatgctgggctccctgggccccaaggagttcaagaaagccttcatcgacttc
taccacagcttcctggataagcactcgattctacgagtgatggtccctcctgccgtggcc
tttgaacttgaccgcacgcggcctgacctctttcctgaggatctccagcggcagttcgtg
caggaggtggtgcagagccagcaggtagccgtggtccggcagctggaggacttccgctcc
aagaagctcatgggcatgacaccctgggagcaggagctggtccagctgggggcctgggtg
gcgcgggaccgtgccagctacgaggcccgggagcggcacctggctgagcggcaactgacc
cacctggaggagatgcagcacaccatctctaacgatgaggagaagagcgccgccgtggtc
aacgccatcagcatgtacatgcggcaccttggggtgcggaccaagagtggggacaagaag
tccgggaggaacttctttcggaaaaagatgatagggaaccggcggtcagatgaaccgacc
aagaccaagaaaggcctgagcagcttcctggatgccgcccgctggaaccggggagagccc
caggattttcgacacccgaaggtcgaagttgatgctgagaagccaggccttacagaacgt
aagggaggtcagggggcgccttcccgggaccggaatctcggaggccctgggcaggacacc
cccggagtttctccgcaccttctgtctggggacagccctgaccgggagccaggtgttgac
gccctcctggaggtgggggacccgcccccacagggcccagccagcctggacgccccagcg
ccgctggagagcacggaggaggctgccgacacagaaagaaagtggaagaggctgtcaggg
cgtctggggcgctcagagagcctgcgggtgagtgaccgccgccggccttcccggggtagc
ctcggggctaagggccggggtgggggccgctcccggagcgacgtggacatggaccccagc
tccgccacggccgtgcttggccctacccgacgagccaccccggagcctggagatgaggga
gagccgggccgctcaggactggagctggaaccagaggagccgcctggctggcgagagctt
gtcccccaggacattctgcacagcctgcccaagagccaggtgaagcggcaggaggtcatc
agcgagctcctggtgacggaggctgcccatgtgcgcatgctccgcgtgctccacgacgtc
ttctaccagcccatagcggacgggggcttctactcccaggaggagctccagaacatcttc
cccagcctggacgagctcatcgaggtgcattccctattccttgattccctgatgaagcgg
aggcaggacagtggctacctcatcaaggagatcggagatgtgctgctggcccggttcgat
ggtgccgagggctcgtggttccagaaaatctcctcccgcttctgtagccgccagtcgttc
gccttagagcagctcaaagccaaacagcgcaaggagccccggttctgtaccttcgtgcag
gaggccgagagccggccccggtgccgccggctgcagctgaaggacatgatccccaccgag
atgcagcgtctgaccaagtacccactgcttctgcagagcatcgagcagaacacagaagag
ccggtggaacgggagaaagtggagcgggcagccgagtgctgccgggaaattctgcaacac
gtcaaccttgccgtgcgggacatggaggacctgctgcggctcaaagattatcagaggcgt
ctggatttgacccacctgcggcagagcaacgaccccatgctgagcgagttcaagaaccta
gacatcaccaagaagaggttgatctacgagggcccactgacgtggcgggtgacgaaggac
aaggctgtggaggtccacgtgctgctgctggatgacctgctgctgctgcttcagcgccag
gacgagcggttcttgcttaagtcgcacagccggacgctgacgcccacgcccgatggcaag
accatgctgcggccagtgctgcggctcacctccgccatgacccgcgaggtggccaccgat
cacaaagccttctatgtcatttttacctgggaccaggaggcccagatatacgagctggtg
gcgcagacggtgtctgagcggaggatctggtgtaccctgatcaccgagaccgctggatgc
ctgaaggtcccctcccgcacctcccgacccaaacaccggcccggccccagcagcactcgt
gaacccctgcttagcagctccgaaaacggcaatggcagccgagagatgcccccggcagat
ggccggatggagagactcttcaactccctcctgcccttctgcagacaaggcctcgagggc
cagctcgccgccaaggcccttcagaaagtgctgaccctgaaacagctcctgttgccttcg
gaggaagacagcggggcagggcctcccctcgaaggggatggggtcccggggggcagcccc
ttgagcccaacgcagccccaggaaattcgggaggagctgctcagcctggaggagaccatt
aaacagctagaggaggtggaggaggaattttgccgcctgagactcctcctgtctcagctt
ggggagaacaccgtcccccagtctggctgtacctga

DBGET integrated database retrieval system