KEGG   Bos taurus (cow): 513377Help
Entry
513377            CDS       T01008                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
bta  Bos taurus (cow)
Pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:bta04810]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:bta04270]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:bta05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
18
AA seq 932 aa AA seqDB search
MGERGETASDTDSPAVPMEAEDVARGAAPGPPRPGLAPVSIIGAEDEDFEIELKTNPEEQ
NNQFQNLDQVKRRPAHLMALLQHVAMQFEPGPLLCCLHADMLGSLGPKEFKKAFIDFYHS
FLDKHSILRVMVPPAVAFELDRTRPDLFPEDLQRQFVQEVVQSQQVAVVRQLEDFRSKKL
MGMTPWEQELVQLGAWVARDRASYEARERHLAERQLTHLEEMQHTISNDEEKSAAVVNAI
SMYMRHLGVRTKSGDKKSGRNFFRKKMIGNRRSDEPTKTKKGLSSFLDAARWNRGEPQGE
VPDFRHPKVEVDAEKPGLTERKGGQGAPSRDRNLGGPGQDTPGVSPHLLSGDSPDREPGV
DALLEVGDPPPQGPASLDAPAPLESTEEAADTESPEPGDEGEPGRSGLELEPEEPPGWRE
LVPQDILHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDVFYQPIADGGFYSQEELQNI
FPSLDELIEVHSLFLDSLMKRRQDSGYLIKEIGDVLLARFDGAEGSWFQKISSRFCSRQS
FALEQLKAKQRKEPRFCTFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIEQNTE
EPVEREKVERAAECCREILQHVNLAVRDMEDLLRLKDYQRRLDLTHLRQSNDPMLSEFKN
LDITKKRLIYEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERFLLKSHSRTLTPTPDG
KTMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTVSERRIWCTLITETAG
CLKVPSRTSRPKHRPGPSSTREPLLSSSENGNGSREMPPADGRMERLFNSLLPFCRQGLE
GQLAAKALQKVLTLKQLLLPSEEDSGAGPPLEGDGVPGGSPLSPTQPQEIREELLSLEET
IKQLEEVEEEFCRLRLLLSQLGENTVPQSGCT
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgggagagagaggcgagacagcgagcgacacggacagcccggcagtgcccatggaggca
gaagacgtcgcccgaggggcggccccggggcccccccgacccggcctggcgcccgtcagc
atcattggggcagaggacgaggattttgagattgagttgaagacgaaccctgaggaacaa
aacaaccagttccagaacctggatcaggtgaagcggcgcccggcccacctcatggccctc
ctgcagcacgtggccatgcagtttgagccgggacccctgctctgctgcctgcatgcggac
atgctgggctccctgggccccaaggagttcaagaaagccttcatcgacttctaccacagc
ttcctggataagcactcgattctacgagtgatggtccctcctgccgtggcctttgaactt
gaccgcacgcggcctgacctctttcctgaggatctccagcggcagttcgtgcaggaggtg
gtgcagagccagcaggtagccgtggtccggcagctggaggacttccgctccaagaagctc
atgggcatgacaccctgggagcaggagctggtccagctgggggcctgggtggcgcgggac
cgtgccagctacgaggcccgggagcggcacctggctgagcggcaactgacccacctggag
gagatgcagcacaccatctctaacgatgaggagaagagcgccgccgtggtcaacgccatc
agcatgtacatgcggcaccttggggtgcggaccaagagtggggacaagaagtccgggagg
aacttctttcggaaaaagatgatagggaaccggcggtcagatgaaccgaccaagaccaag
aaaggcctgagcagcttcctggatgccgcccgctggaaccggggagagccccagggtgag
gtgcccgattttcgacacccgaaggtcgaagttgatgctgagaagccaggccttacagaa
cgtaagggaggtcagggggcgccttcccgggaccggaatctcggaggccctgggcaggac
acccccggagtttctccgcaccttctgtctggggacagccctgaccgggagccaggtgtt
gacgccctcctggaggtgggggacccgcccccacagggcccagccagcctggacgcccca
gcgccgctggagagcacggaggaggctgccgacacagaaagcccggagcctggagatgag
ggagagccgggccgctcaggactggagctggaaccagaggagccgcctggctggcgagag
cttgtcccccaggacattctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
atcagcgagctcctggtgacggaggctgcccatgtgcgcatgctccgcgtgctccacgac
gtcttctaccagcccatagcggacgggggcttctactcccaggaggagctccagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctattccttgattccctgatgaag
cggaggcaggacagtggctacctcatcaaggagatcggagatgtgctgctggcccggttc
gatggtgccgagggctcgtggttccagaaaatctcctcccgcttctgtagccgccagtcg
ttcgccttagagcagctcaaagccaaacagcgcaaggagccccggttctgtaccttcgtg
caggaggccgagagccggccccggtgccgccggctgcagctgaaggacatgatccccacc
gagatgcagcgtctgaccaagtacccactgcttctgcagagcatcgagcagaacacagaa
gagccggtggaacgggagaaagtggagcgggcagccgagtgctgccgggaaattctgcaa
cacgtcaaccttgccgtgcgggacatggaggacctgctgcggctcaaagattatcagagg
cgtctggatttgacccacctgcggcagagcaacgaccccatgctgagcgagttcaagaac
ctagacatcaccaagaagaggttgatctacgagggcccactgacgtggcgggtgacgaag
gacaaggctgtggaggtccacgtgctgctgctggatgacctgctgctgctgcttcagcgc
caggacgagcggttcttgcttaagtcgcacagccggacgctgacgcccacgcccgatggc
aagaccatgctgcggccagtgctgcggctcacctccgccatgacccgcgaggtggccacc
gatcacaaagccttctatgtcatttttacctgggaccaggaggcccagatatacgagctg
gtggcgcagacggtgtctgagcggaggatctggtgtaccctgatcaccgagaccgctgga
tgcctgaaggtcccctcccgcacctcccgacccaaacaccggcccggccccagcagcact
cgtgaacccctgcttagcagctccgaaaacggcaatggcagccgagagatgcccccggca
gatggccggatggagagactcttcaactccctcctgcccttctgcagacaaggcctcgag
ggccagctcgccgccaaggcccttcagaaagtgctgaccctgaaacagctcctgttgcct
tcggaggaagacagcggggcagggcctcccctcgaaggggatggggtcccggggggcagc
cccttgagcccaacgcagccccaggaaattcgggaggagctgctcagcctggaggagacc
attaaacagctagaggaggtggaggaggaattttgccgcctgagactcctcctgtctcag
cttggggagaacaccgtcccccagtctggctgtacctga

DBGET integrated database retrieval system