KEGG   Bos taurus (cow): 513608Help
Entry
513608            CDS       T01008                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    513608 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    513608 (ARG1)
   00330 Arginine and proline metabolism
    513608 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    513608 (ARG1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     513608 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
9
AA seq 322 aa AA seqDB search
MSSKPQSIGVIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKELECDVKDYGDLSFADNLD
DSPFQIVKNPRCVGKASEKLADVVAEVKKTGRISLVLGGDHSLAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTKTGNLHGQPVSFLLKELKEKMPEVPGFYWVAPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVQGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTTVAIT
MACFGVAREGNHKPIDYLSPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagccacagtccatcggggtcattggagctcccttctcaaagggccagcca
cgaggaggggtggaagaaggccctacagtacttagaaaggctggtctgcttgagaaactt
aaagaactagagtgtgatgtgaaagattatggggacctgtcctttgctgataatcttgat
gacagtccctttcaaattgtgaagaatccaaggtgtgtgggaaaagcaagtgaaaagctg
gctgatgtggtggcagaagtcaagaagactggaaggatcagccttgtcctgggcggagac
cacagtttggcgatcggcagcatctctggccatgccagggtccacccagacctctgtgtc
atttgggtggatgctcacacggacatcaacactccactgacaaccaaaaccgggaacttg
catggacaacctgtgtctttccttctgaaggaactaaaggaaaagatgcctgaggtccca
ggattctactgggtggctccctgcatatctgccaaagacattgtgtatattggtctgaga
gatgtggaccctggggaacactatattttgaaaactctgggaattaaatacttttcaatg
actgaagtggataaactgggaattggcaaggtgatggaagaaacattcagctatctacta
ggaagaaagaaaaggccaattcatttgagctttgatgttgatggactggacccatctttc
acgccagctactggcacaccagtccagggaggtctgacttacagagaaggtctctacatc
acagaagaaatttacaaaacaggtttactctcaggattagatataatggaagtgaatccg
tctctggggaagacaccagaagaagtgactcgaacagtgaacacaacagtagcaataacc
atggcttgctttggggttgctcgagagggtaaccataaacctattgattaccttagccca
ccaaagtaa

DBGET integrated database retrieval system