KEGG   Bos taurus (cow): 513895Help
Entry
513895            CDS       T01008                                 

Gene name
PFN1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
bta  Bos taurus (cow)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    513895 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    513895 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    513895 (PFN1)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   513895 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH
GGMINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgca
gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccggcaagaccttc
gtcaacatcacgcctgctgaggtcggtatcctggttggcaaagaccggtcaagttttttc
gtgaacgggctaacacttgggggccagaaatgttctgtgatccgggactcactgctgcag
gatggagaatttaccatggatcttcgtaccaagagcaccggtggagccccaaccttcaat
atcacggtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggcggtatgatcaacaagaaatgttatgaaatggcttctcacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system