KEGG   Bos taurus (cow): 513992Help
Entry
513992            CDS       T01008                                 

Gene name
CES5A, CES7
Definition
carboxylesterase 5A (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     513992 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 576 aa AA seqDB search
MSGEWVHPGQTLIWAVWVLAAATKGPATADAPARHTNLGWVQGTQASVLGNDMLVNVFLG
VPYAAPPVGPLRFAKPEPLLPWDGFLNATSYPKLCFQNSEWLFTDQHILKVHYPKFRVSE
DCLYLNIYAPAHAETGSKLPVMVWLPGGAFETGSASIFDGSALASYEDVLVVTIQYRLGI
FGFFNTGDEHARGNWAFMDQVAALIWVQENIEFFGGDPRCVTIFGESAGAISVSSLILSP
MTKGLFHRAIMESGVAIIPYLKAPDYERNDDLQTIASICDCSASDSIALLQCLRAKSSKE
LLSINQKTKSFTRVVDGLFFPNEPLDLLAQKLFHLVPSIIGVNNHECGFLLPMKEFPEIL
WGSNKSLALQLIHSVLHIPVQYLYLVANEYFHNKHSLVDIRNRFLDLLGDVFFVIPGLVT
AQYHTDAGAPVYFYEFQHRPQCLKDRKPSFVKADHTDEIRFVFGGAFLKGNIVMFEEATE
EEKGLSRKMMRYWANFARTGNPNGKGLPLWPAYRQSEEYLQLDLNISVGQRLKELELKFW
TETLPLMMTSSGALLASLSSSTFLFLLLPFIFSFAP
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggagtgggtgcacccaggccagaccctgatctgggctgtttgggtccttgca
gctgccaccaaggggccagccaccgctgatgcaccagccaggcacaccaacctgggatgg
gtccaggggacgcaagcttctgttctgggaaacgacatgctcgtgaatgtgttccttggg
gtcccttatgccgcaccccctgtagggcccctgcgatttgcaaaaccagagcctttactg
ccctgggatggtttcctaaatgccacgtcctaccctaaattgtgcttccagaactcagag
tggctgttcacagatcaacacattctcaaggtgcattaccccaaattcagagtatcggaa
gactgcctgtatcttaacatctacgcaccggcccatgcagaaactggctccaagctcccg
gtcatggtgtggctccctggcggcgccttcgagactggctcagcgtccatctttgatggg
tccgccctggcttcctatgaggacgtgctggttgtgaccattcagtaccgactaggaata
ttcggcttcttcaacacaggggacgagcatgcgcgggggaactgggccttcatggatcag
gtggctgctctgatctgggtccaggaaaacattgagttcttcggtggggacccacgctgc
gtgaccatcttcggcgagtcagcaggagcgataagtgtttccagccttattctgtccccc
atgaccaaaggcttattccacagagccatcatggagagtggggtggccatcatcccttac
ctgaaggcccctgattatgagaggaatgatgatttgcagacaattgcaagtatttgtgac
tgcagcgcgtcggactccattgccctgctgcagtgcctgcgggcaaagtcctccaaggag
ttgctgagcatcaaccagaaaaccaagtctttcactcgagtggttgatggccttttcttt
cctaatgagccgctagacctgttggctcaaaaattatttcatctggttccttccatcatc
ggagtcaataaccacgagtgtggcttcctgctacccatgaaggagtttcctgagatcctc
tggggctccaacaagtccctcgccctgcaactgatacactcagtcctgcacatccctgtc
cagtatttataccttgtggctaatgaatatttccacaataagcactctctggtcgatata
cgaaatcgcttcctggatttgcttggagatgtgttctttgtgatccctgggctggtcaca
gctcaatatcacacagatgctggtgcccctgtctacttctatgagtttcagcatcggccc
cagtgcttgaaggacaggaagccatcttttgtcaaggctgatcacactgatgaaatccgc
ttcgtctttggaggcgccttcctgaagggcaacattgtcatgtttgaagaagccacagag
gaagagaaagggctgagcaggaagatgatgagatactgggctaactttgctcggactggg
aatcctaatgggaaaggtctgcctctgtggccggcctacaggcagtctgaggaatacttg
cagctggacttgaacataagcgtgggacagagattgaaagagctggagctgaaattttgg
acagaaaccctccccttaatgatgacctcgtccggagctctcctggcttctctttcttcc
tcaaccttcctttttctactcctgcctttcattttctcttttgctccctga

DBGET integrated database retrieval system