KEGG   Bos taurus (cow): 514102Help
Entry
514102            CDS       T01008                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    514102 (SETD1B)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     514102 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
17
AA seq 2054 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHLTLHCFQRAGEWEMFCFPFGFNVLQTPFPLVPC
QIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVV
FATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAV
SPIVNETLQLSDALKRLKDGGLSAGCGSSSSSVTPNSGGTPFSQDTAYSSCRLDTPNSYG
QGTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPTTTFKARRHESKFTDAYNRRHEHHYV
HNSSAVTAVAGATAAFRGAVDLPFGAVGGSGGSSGPPFKAQPQDSATFAHTPPPTQATPA
PGVAFKSAFSPYQTPVPPFPPPPEEPTTTAPFGARDSGEFRRAPAPPPLPPAEPLTKEKP
GTPPGPPPPEANSIELGGRPTFGWSPEPCDSPGTPTLESSPAGPEKPHDSLDSRIEMLLK
EQRTKLPFLREQDSDTELQMEGSPISSSSSQLSPLAPFGANSQPGFRGPTPPSSRPSSTG
LEDISPTPLPDSDEDGELDLGLGPRPPPEPGPPDPTGLLGQTSETALDLAGDRTPTSEKM
DEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGAVAAPSVLAPTLPLPPPPGFP
PLPPPPPPPPPQPGFPMPPPLPPPPPPPPPAHPAVTVPPPPLPAPPPGVPPPPILPPLPP
FPPGLFPVMQVDMSHVLGGQWGSMPMSFQMQTQMLSRLMTGQGTCPYPPFMAAAAAAASA
GLQFVNLPPYRGPFSLGNTGPGRGQPWPPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLV
VLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDR
IASCLLESWGKGEGLSYEGLGLGIGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSV
DEEDEESERERDRDMADAPCELAKRDPKGMGVRRRPARPLELDSGGEEDEKESLSVSSSS
SASSSSGSSTTSPSSSASDKEERESTEEEEEGEGEEEGEEGPRSQISSSSTSSMSDKDDD
DEDSDDRDESENDDEDTALSEASEKEEGDSDGEETVSITTSKPGAESSSESSESSDFASS
SESSSSSSSEDEEELPAGEDEEEEEEEGEAAADESMAPTAPDEDFENEVVTGAPTTESQG
PEEEVDIEAEDEAPKERTPMLEEPPLPVSVEELTGCKEPPGEPGLNQEGARLLSPEPPAG
EMEARPLPSPEPTPEDNLEAEPEAPALLSLPLQPPLPPPRPPRPPSPPPEPKTPDPPLPS
VPLEPPPHEEQPPRTPSLCGSLGKSQSAEAVPATPSGEPLPTAGSGGLALSSPQLPGSPF
SYPSPSPSLSSGGLPRTPGRDFSFTPTFPEPGGPLLLPVCPLPAGRRDDRSGPLASPVLL
ETGLPLPLPLPLPLPLALPVPVLRAQSRAPTQLPPLLPAPLAPCPPPIKRKPSGPRRSPP
AVLTLDGPLVRPPGGAALGRDLLLLPGQPQTPVFPSTHDPRTVTLDFRNAGIPAPPPPLP
PQPPPPPPPPPVEPTKLPFKELENQWPSEAIPPGPRGRDEISDEFMAKVRGSWRRPPKKR
HEDLVVSASPELSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNG
MDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHMTGCARSEGFYTIDKKDKLRYLNSSRAS
TDEPPTDTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLK
FCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDT
IIDATKCGNFARFINHSCNVSVRLGATPPGACREDLEAAGTGASMASFPSMGRGRGAQEG
GRSVMPCLRSPSPLTFSFPVCQMALMRPEVYLTRSIYYKFPIEDVKIPALGSENCRGPST
RPAPGCQPPRLPSVDPGSLGPGPTPHPHFRCCPSTQWPCQGLAPPTLPPRSHRSSGPSVG
KGFSVSARVSFIFF
NT seq 6165 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccttacccttcattgttttcaaagagcgggcgagtgggaa
atgttctgctttcccttcggtttcaatgttctccaaactcccttccccctcgtcccctgc
cagatcgatgagttctatgtgggcccggtgcctccgaagcaggtgacatttgccaagctg
aatgataacatccgtgaaaacttcctaagggacatgtgcaagaagtatggggaggtggag
gaggtggagattttgtacaaccccaagaccaagaagcacttgggcattgccaaagtggtc
tttgccacggtcaggggagccaaggaggccgttcagcacttgcatagcacttcggtcatg
ggtaatatcatccacgtggagctggacaccaaaggggaaacccgcatgcggttctacgaa
ctgttggtcacgggccgatacacaccccaaaccctgccagtgggtgagctggacgctgtc
tctccaatcgtgaatgagaccctgcagctgtcagatgccctgaagcgcctcaaagatggt
ggcctgtctgcaggctgtggctccagctcgtcctctgtcacccccaatagtggtgggaca
cccttctcccaggacacagcttattccagctgccgcttggacacacccaactcatacggc
cagggcacgccgctcacgccacgcctgggcacccccttctcgcaggactcgagctattcc
agccgccagcccacgccctcctacctcttcagccaggatcccacaacgaccttcaaggct
cggcgccacgagagcaagttcacagatgcctacaaccgccgccacgagcaccattatgtc
cacaactcgtctgctgtcactgcagtggcaggggccacagctgccttccggggtgcggtg
gacctcccattcggggcagttggcggcagtgggggcagcagtgggcccccattcaaggcc
caaccacaggattctgccacgtttgcccacactcctccgcccacccaagcaacccctgcg
cccggagtcgccttcaagtcagctttctctccgtatcagactcctgtgcccccttttccc
ccaccccctgaggagcccaccaccacagccccctttggggcccgtgacagtggcgagttc
cgaagagcacctgcgcccccacccctgccacccgccgagcccctgacaaaggagaagcct
ggcacaccgccgggacccccgccccctgaggccaacagcatagagctgggtggtcggcca
accttcggctggagtcctgagccttgtgacagtcccggcacgcctacgctggagtcgtcg
cccgcagggccagagaagccccatgacagcttagactctcggatcgagatgctgctgaag
gagcagcgcaccaagctgcccttccttcgggagcaggactcagacacagagctgcagatg
gagggcagccccatctcctcctcctcctcccagctctccccactggccccctttggcgct
aactctcagccaggctttcgaggccctacaccaccctcttcgcgcccctccagcactggc
ctggaagatatcagccccacgccactgcctgactcagatgaggatggtgagcttgatctg
ggcctggggcctcggcccccacccgagccgggtcccccagaccctactggtcttctgggt
cagacaagtgagacggccttggacctggctggagacaggaccccaacctcagagaagatg
gatgaggggcagcagtcctcaggggaggacatggagatctcagacgacgagatgccctcg
gcccccatcaccagcgctgactgccccaagcccatggtggtgaccccaggggccggggcc
gtggcagctccctccgtgctggccccaaccttgccactgcccccgccccctggcttccca
ccactgcccccgcccccacccccacccccaccccagcccggcttccccatgcccccacct
ctgccaccaccaccgcccccgccacccccggcccatccagctgtgacagtgcccccacca
cccctgccagccccgccgcctggtgtcccacccccacccattctgccgccactgccgccc
ttcccaccagggctgtttcctgtgatgcaggtggacatgagccacgtgctggggggccag
tggggcagcatgcccatgtccttccagatgcaaacgcagatgctgagccgtctgatgacg
ggccagggcacatgcccctacccccccttcatggctgccgcagctgcagccgcctccgcc
ggactgcagtttgtcaacctgccgccctaccggggccccttctcccttggtaacactggc
ccaggccgcgggcagccctggccacccctgcccaagtttgacccatcagtgccaccacca
ggctatgtgccccgccaggaggacccgcataaggccactgtggacggcgtcctgctggtg
gtgctcaaagagctcaaggccatcatgaagcgggacctgaaccgcaagatggtggaggtg
gtggccttcagggccttcgatgagtggtgggacaagaaggaacggatggctaaggcctcg
ctgaccccagtgaagtcgggtgagcacaaagatgaggacaggccgaagcccaaggaccgc
atcgcctcttgcctgctggagtcctggggcaagggcgagggcctgagctacgaggggctg
ggcctgggcatcgggctgcgcggggccattcgactgccctccttcaaggtcaagaggaag
gaaccgccagacacagcctcgtctggtgaccagaagcggctgcgcccctccacctctgtg
gatgaggaggacgaagagtctgagcgtgagcgggaccgggacatggccgacgccccctgt
gagctcgccaagcgggaccccaagggcatgggcgtgcggcggcggccagcccggcccctg
gagctggacagcggcggggaggaggacgagaaggagtcgctgtcggtgtcgtcttcctcg
tcagcatcctcgtcctcgggctcctcgaccacctcaccctcgtcctcagcctctgataag
gaggagcgagaaagcacggaggaggaagaggaaggggagggggaggaggagggggaggag
ggccccaggagccagatctcctcctcctcaacctcatccatgtcagataaggatgatgat
gatgaagacagcgacgaccgggatgagtctgagaatgatgacgaggacacagccctgtca
gaggcgagtgagaaggaagaaggggactcagatggagaggagacggtgagcatcaccacc
tccaagcctggagctgagtcctccagtgagagttctgagtcatctgacttcgcatcaagc
tccgagtcctcttcatcatcatcctcagaagatgaagaagagctgccagctggggaggat
gaggaagaggaggaggaggaaggggaggcagctgcagacgagagcatggctcccactgct
cctgacgaggactttgagaatgaagtcgtcacaggagcacccacaacggagtcacagggc
ccagaagaggaggtggacattgaggctgaggacgaggcccctaaggagcggaccccgatg
ctggaagagccccccttgcctgtgagtgttgaggagctgactggctgcaaggagcccccc
ggggaaccaggcctgaaccaggaaggggccaggttgctgtctccagaaccccctgcagga
gagatggaggcccggcccctgccatccccagagcctaccccagaggacaacctggaagcg
gagcctgaggccccggcactgctttctttaccgctgcagccaccattgccgccgcctcga
ccgccccggccacccagcccaccaccagagcccaagaccccagaccccccactcccatcc
gtccctctggagcctcccccccatgaggagcagcccccacgtactccgagcctctgtggc
agcctgggcaagtcccagagcgccgaggcggtgccggccacgccgagtggggagcccttg
ccgacggcgggcagtggcggcctggccctgagctccccgcagctgcccggtagccccttc
tcctacccatccccatcccccagcttgagcagcgggggcctcccaaggacacctggccgg
gacttcagcttcacacccaccttccccgagcctgggggccccctacttctgcctgtctgc
cccctcccagctggccggcgtgacgatcggtctggccccctggcctccccggtgctcctg
gagacaggcttgccgcttcctttgcccttgcccttgcccctgcccctggcgttgcccgta
cctgtcctgcgggcccagtcgcgggcccccacccagctgccccctctgctgcctgctcca
ctggccccttgcccaccccccatcaagaggaagccgagcgggccccggcgatccccgcca
gctgtgctcaccttggatgggcctttggtccgaccgccaggaggggccgccctgggcagg
gacctcctgcttctgccaggccagccacagacccctgtcttccccagcacccatgatccc
cggaccgtgaccctggacttccggaacgcggggatcccagcccctccaccacccttgccc
ccccagccccctccacccccacctccaccacctgttgagcccaccaagctgccctttaag
gagctagagaaccagtggccttctgaggccatacctccgggtccccgtgggcgtgacgag
atctccgacgagttcatggccaaggtgcgggggtcctggcgccggccaccgaagaagcgc
catgaggacctggtggtctcagcctcgcccgagctctcgccaccgcagcctctcttccgg
ccccgctcagagtttgaggagatgaccatcctctatgacatctggaatggtggcattgac
gaggaggacatccgcttcctgtgtgttacctacgagcggctgctgcagcaggacaacggc
atggactggctcaacgacacgctctgggtctaccatccctccaccagcctctcttcagct
aagaagaagaaacgggacgacggcatccgggagcacatgacgggctgtgcccgaagtgag
ggcttctataccatcgacaagaaggacaagctcagatacctcaacagcagtcgtgctagc
accgacgagccccccacggacacccagggcatgagcattcccgcgcagccgcacgcctcc
acacgggcaggctccgagcggcgatctgagcagcggcgcctgttgtcctccttcactggc
agttgtgacagcgacctgctcaagttcaaccagctcaagttccggaagaaaaagctcaaa
ttctgcaagagtcacattcacgactggggcctgttcgccatggagcccatcgcggccgac
gagatggttatcgagtatgtgggccagaacatccgccaggtgatcgcggacatgcgggag
aaacgttacgaggacgagggcatcggtagcagctacatgttccgggtggaccacgacacc
attatcgacgccaccaagtgcggcaacttcgcgcgtttcatcaaccacagctgcaacgtg
agtgtgcggctcggggccacgcccccgggggcgtgccgcgaggacctggaagccgctggc
acaggagccagcatggcctcctttccaagcatggggcgaggacggggggctcaggaggga
ggacgcagtgtgatgccttgtctgaggagcccttctcctctgaccttcagttttcccgtc
tgtcaaatggccctaatgagaccagaggtgtacctgacacggtccatatactacaagttc
cccatcgaggacgtcaagatccctgctctgggctctgagaactgccggggaccctcaact
aggccggcacccgggtgtcagccaccccggctcccaagcgtggaccccggctctctgggg
ccgggtcccaccccccacccccatttcaggtgctgtccctctacccagtggccgtgccag
ggcctggcgcccccaacactaccccccaggtcccaccgcagctccggcccctcagtggga
aagggcttctctgtctcagcccgtgtctccttcatttttttttaa

DBGET integrated database retrieval system