KEGG   Bos taurus (cow): 514113Help
Entry
514113            CDS       T01008                                 

Gene name
UOX
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bta  Bos taurus (cow)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    514113 (UOX)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    514113 (UOX)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     514113 (UOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 304 aa AA seqDB search
MAHYHNDYQKNDEVEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLNSRREYLHG
DNSDIIPTDTIKNTVQVLAKFKGIKSIETFAMNICEHFLSSFNHVIRVQVYVEEVPWKRF
EKNGVKHVHAFIHTPTGTHFCEVEQLRSGPPVIHSGIKDLKVLKTTQSGFEGFLKDQFTT
LPEVKDRCFATQVYCKWRYHQGRDVDFEATWEAVRGIVLKKFAGPYDKGEYSPSVQKTLY
DIQVLSLSQLPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKL
TSRL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctcattaccataatgactatcaaaagaatgatgaagtggagtttgtccgaactggt
tatggtaaggatatggtaaaagttcttcatattcagcgggatggaaaataccacagcatt
aaggaagtggcaacttcagtgcaacttactctaaactccagaagagagtacctgcatgga
gacaattcagacatcatcccgacagacaccatcaagaacacagttcaagtcctggccaag
ttcaaaggcatcaaaagcatagaaacttttgctatgaatatctgtgagcatttcctttct
tcttttaaccacgtcattcgagttcaagtctacgtggaagaagtcccttggaagcgtttt
gaaaagaatggagttaagcacgtccatgcatttattcatactcccactggaacgcatttc
tgtgaggttgaacagttgaggagtggacctccagtcattcattctggaatcaaagacctc
aaggtcctgaaaacaacgcagtctggatttgaaggattcctcaaggatcagttcaccacc
ctccctgaggtgaaggaccggtgctttgctacccaagtgtactgcaaatggcgctaccac
cagggcagagatgtggactttgaggccacctgggaggctgtcaggggcattgtcctgaag
aagttcgctggaccctatgacaaaggcgagtactcgccctcagtccagaagaccctctat
gacatccaggtgctctccctgagccagcttcctgagatagaagatatggaaatcagtctg
ccgaacattcactactttaacatagacatgtccaaaatgggactgatcaacaaggaagag
gtcttgttaccattagacaatccatatggcagaattactggtacagtcaagaggaagctg
acttcaaggctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system