KEGG   Bos taurus (cow): 514113Help
Entry
514113            CDS       T01008                                 

Gene name
UOX
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bta  Bos taurus (cow)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bta00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:bta00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 304 aa AA seqDB search
MAHYHNDYQKNDEVEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLNSRREYLHG
DNSDIIPTDTIKNTVQVLAKFKGIKSIETFAMNICEHFLSSFNHVIRVQVYVEEVPWKRF
EKNGVKHVHAFIHTPTGTHFCEVEQLRSGPPVIHSGIKDLKVLKTTQSGFEGFLKDQFTT
LPEVKDRCFATQVYCKWRYHQGRDVDFEATWEAVRGIVLKKFAGPYDKGEYSPSVQKTLY
DIQVLSLSQLPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKL
TSRL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctcattaccataatgactatcaaaagaatgatgaagtggagtttgtccgaactggt
tatggtaaggatatggtaaaagttcttcatattcagcgggatggaaaataccacagcatt
aaggaagtggcaacttcagtgcaacttactctaaactccagaagagagtacctgcatgga
gacaattcagacatcatcccgacagacaccatcaagaacacagttcaagtcctggccaag
ttcaaaggcatcaaaagcatagaaacttttgctatgaatatctgtgagcatttcctttct
tcttttaaccacgtcattcgagttcaagtctacgtggaagaagtcccttggaagcgtttt
gaaaagaatggagttaagcacgtccatgcatttattcatactcccactggaacgcatttc
tgtgaggttgaacagttgaggagtggacctccagtcattcattctggaatcaaagacctc
aaggtcctgaaaacaacgcagtctggatttgaaggattcctcaaggatcagttcaccacc
ctccctgaggtgaaggaccggtgctttgctacccaagtgtactgcaaatggcgctaccac
cagggcagagatgtggactttgaggccacctgggaggctgtcaggggcattgtcctgaag
aagttcgctggaccctatgacaaaggcgagtactcgccctcagtccagaagaccctctat
gacatccaggtgctctccctgagccagcttcctgagatagaagatatggaaatcagtctg
ccgaacattcactactttaacatagacatgtccaaaatgggactgatcaacaaggaagag
gtcttgttaccattagacaatccatatggcagaattactggtacagtcaagaggaagctg
acttcaaggctgtga

DBGET integrated database retrieval system