KEGG   Bos taurus (cow): 514159Help
Entry
514159            CDS       T01008                                 

Gene name
ACSL5
Definition
acyl-CoA synthetase long-chain family member 5 (EC:6.2.1.3)
Orthology
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bta01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bta00071]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:bta04146]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:bta04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:bta03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 683 aa AA seqDB search
MLFIFNFLFSPLPTPALICILTFGAAIFLWLVNRPQPALPHVDLNKQSVGIEGGARRSIC
QKDNDLIRYYFSDAKTTYEIFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGS
CLLHKGYKPSQESFVGIFAQNRPEWVISEFACYTYSMVAVPLYDTLGAEAVIYIINKADI
AMVICDTPQKALVLISNVEKGLTPGLKLVILMDPFEDDLKKRGEKCGVEILSLFDAENLG
KENFRKPVPPAPEDLSIICFTSGTTGDPKGAMLTHANIVSNASGFLKCMEGVFEPNPEDV
CISYLPLAHMFERIVQVIVFSYGAKVGFFQGDIRLLPDDMRTLKPTLFPTVPRLLNKVYD
KVQNEAKTPLKKFLLNLAVASKFREVKRGIIRRDSLWDKLIFGKIQESLGGKVRLLITGA
APISPPVLTFLRAALGCLVFEAYGQTECTAGCTVTLPGDWKSGHVGVPMACNHVKLEDVP
DMNYFAVNNEGEICIRGHNVFKGYLKEPEKTQETLDKDGWLHTGDIGRWLPNGTLKVIDR
KKNIFKLAQGEYIAPEKIETVYIRSSLVSQIFVHGESLQSFLVGVVVPDPDALPPFAAKI
GVKGSIEELCQNQTIKKAILEDMHKIGIDGGLKSFEQVKCIHLHPEPFSIENGLLTPTLK
AKRGDLAKHFGTQIKSLYENTQE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgctttttatctttaacttcttattttccccacttccaaccccggcactgatctgcatc
ctgaccttcggagctgccatcttcctgtggttggttaacagacctcagcccgccttgcct
catgttgatctgaacaagcagtcggtgggaattgagggaggagcacggagaagtatttgc
cagaaggacaatgacctaatacgctactacttctcagatgccaagacgacatatgaaatc
ttccaaagaggacttgctgtgtctgacaatgggccttgcctgggatatagaaaaccaaac
cagccctacagatggctgtcctacaaacaggtgtctgatcgagcagagtacctgggctcc
tgtctcttgcataaaggatataaaccatcacaagaaagctttgttggtatctttgctcag
aataggccagagtgggtcatctctgagttcgcctgttacacgtactccatggtagctgtg
cccttgtatgacaccttgggagcagaagctgtcatatacatcatcaacaaggctgatatc
gccatggtaatctgtgatacaccccaaaaggcattggtcctgatcagtaatgtggaaaag
ggcctcaccccaggcctgaaattggtcatcctcatggatccctttgaggatgacctgaag
aagagaggggagaaatgtggagttgaaatcttatccctgtttgatgctgagaatttaggc
aaagagaacttcagaaaacccgtgcctcctgcaccagaagatctcagcatcatttgcttt
accagtgggaccacaggtgatcccaaaggagccatgttaacccatgcaaatattgtttcc
aatgcttctggttttctcaaatgtatggagggtgtttttgagcccaatcctgaggacgtg
tgtatatcctacctccccttggctcatatgtttgaaaggattgtacaggtcatcgtgttc
tcttatggagccaaagtcggattcttccaaggagacattcggctgctgcctgacgacatg
aggaccctgaagcccacattgttccccacagtgcctcgactccttaacaaggtctatgat
aaggtacaaaatgaagccaagacacccttgaagaagttcttgttgaacttagctgttgcc
agtaaattccgtgaagtgaaaaggggtatcatcagacgtgacagtctgtgggacaagctc
atctttggaaagatccaggaaagcctgggtgggaaggttcggttactgatcaccggagct
gcccccatctcacctcccgtcttgacgttcctccgggcagcactgggatgtctggtgttt
gaagcttatggtcaaacagaatgcactgctggctgtacagttacattacctggggattgg
aaatcaggccacgttggagtccccatggcttgcaatcatgtgaagctggaagatgtacct
gatatgaactactttgccgtgaacaatgaaggagagatctgcatcaggggccacaacgtg
ttcaaaggatacctgaaggagcccgagaagacacaggaaaccttggacaaggatggctgg
cttcacacaggagacattggtcgctggctcccgaacggaactctgaaggtcatcgaccga
aaaaagaacattttcaagctggcccaaggagaatacattgctccagagaagatagaaact
gtctacatcaggagtagtctggtgtcgcagatttttgtacatggggaaagcttacagtca
ttcctagtgggagtggtggttcctgacccagatgcacttcccccatttgcagccaagatt
ggggtaaagggctctattgaagaactgtgtcaaaaccaaactataaagaaagccatatta
gaagacatgcataaaattgggatagacggtggccttaaatcctttgaacaggtcaagtgc
atccatctacatccagagccattttccattgaaaatggactcttgacaccaaccttgaaa
gcaaagcggggagaccttgccaagcactttggaactcaaatcaagagtctgtatgagaac
acccaggagtag

DBGET integrated database retrieval system