KEGG   Bos taurus (cow): 514159Help
Entry
514159            CDS       T01008                                 

Gene name
ACSL5
Definition
acyl-CoA synthetase long-chain family member 5 (EC:6.2.1.3)
Orthology
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    514159 (ACSL5)
  Lipid metabolism
   00071 Fatty acid degradation
    514159 (ACSL5)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    514159 (ACSL5)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    514159 (ACSL5)
   03320 PPAR signaling pathway
    514159 (ACSL5)
Enzymes [BR:bta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     514159 (ACSL5)
Lipid biosynthesis proteins [BR:bta01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   514159 (ACSL5)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   514159 (ACSL5)
  Exosomal proteins of breast cancer cells
   514159 (ACSL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 683 aa AA seqDB search
MLFIFNFLFSPLPTPALICILTFGAAIFLWLVNRPQPALPHVDLNKQSVGIEGGARRSIC
QKDNDLIRYYFSDAKTTYEIFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGS
CLLHKGYKPSQESFVGIFAQNRPEWVISEFACYTYSMVAVPLYDTLGAEAVIYIINKADI
AMVICDTPQKALVLISNVEKGLTPGLKLVILMDPFEDDLKKRGEKCGVEILSLFDAENLG
KENFRKPVPPAPEDLSIICFTSGTTGDPKGAMLTHANIVSNASGFLKCMEGVFEPNPEDV
CISYLPLAHMFERIVQVIVFSYGAKVGFFQGDIRLLPDDMRTLKPTLFPTVPRLLNKVYD
KVQNEAKTPLKKFLLNLAVASKFREVKRGIIRRDSLWDKLIFGKIQESLGGKVRLLITGA
APISPPVLTFLRAALGCLVFEAYGQTECTAGCTVTLPGDWKSGHVGVPMACNHVKLEDVP
DMNYFAVNNEGEICIRGHNVFKGYLKEPEKTQETLDKDGWLHTGDIGRWLPNGTLKVIDR
KKNIFKLAQGEYIAPEKIETVYIRSSLVSQIFVHGESLQSFLVGVVVPDPDALPPFAAKI
GVKGSIEELCQNQTIKKAILEDMHKIGIDGGLKSFEQVKCIHLHPEPFSIENGLLTPTLK
AKRGDLAKHFGTQIKSLYENTQE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgctttttatctttaacttcttattttccccacttccaaccccggcactgatctgcatc
ctgaccttcggagctgccatcttcctgtggttggttaacagacctcagcccgccttgcct
catgttgatctgaacaagcagtcggtgggaattgagggaggagcacggagaagtatttgc
cagaaggacaatgacctaatacgctactacttctcagatgccaagacgacatatgaaatc
ttccaaagaggacttgctgtgtctgacaatgggccttgcctgggatatagaaaaccaaac
cagccctacagatggctgtcctacaaacaggtgtctgatcgagcagagtacctgggctcc
tgtctcttgcataaaggatataaaccatcacaagaaagctttgttggtatctttgctcag
aataggccagagtgggtcatctctgagttcgcctgttacacgtactccatggtagctgtg
cccttgtatgacaccttgggagcagaagctgtcatatacatcatcaacaaggctgatatc
gccatggtaatctgtgatacaccccaaaaggcattggtcctgatcagtaatgtggaaaag
ggcctcaccccaggcctgaaattggtcatcctcatggatccctttgaggatgacctgaag
aagagaggggagaaatgtggagttgaaatcttatccctgtttgatgctgagaatttaggc
aaagagaacttcagaaaacccgtgcctcctgcaccagaagatctcagcatcatttgcttt
accagtgggaccacaggtgatcccaaaggagccatgttaacccatgcaaatattgtttcc
aatgcttctggttttctcaaatgtatggagggtgtttttgagcccaatcctgaggacgtg
tgtatatcctacctccccttggctcatatgtttgaaaggattgtacaggtcatcgtgttc
tcttatggagccaaagtcggattcttccaaggagacattcggctgctgcctgacgacatg
aggaccctgaagcccacattgttccccacagtgcctcgactccttaacaaggtctatgat
aaggtacaaaatgaagccaagacacccttgaagaagttcttgttgaacttagctgttgcc
agtaaattccgtgaagtgaaaaggggtatcatcagacgtgacagtctgtgggacaagctc
atctttggaaagatccaggaaagcctgggtgggaaggttcggttactgatcaccggagct
gcccccatctcacctcccgtcttgacgttcctccgggcagcactgggatgtctggtgttt
gaagcttatggtcaaacagaatgcactgctggctgtacagttacattacctggggattgg
aaatcaggccacgttggagtccccatggcttgcaatcatgtgaagctggaagatgtacct
gatatgaactactttgccgtgaacaatgaaggagagatctgcatcaggggccacaacgtg
ttcaaaggatacctgaaggagcccgagaagacacaggaaaccttggacaaggatggctgg
cttcacacaggagacattggtcgctggctcccgaacggaactctgaaggtcatcgaccga
aaaaagaacattttcaagctggcccaaggagaatacattgctccagagaagatagaaact
gtctacatcaggagtagtctggtgtcgcagatttttgtacatggggaaagcttacagtca
ttcctagtgggagtggtggttcctgacccagatgcacttcccccatttgcagccaagatt
ggggtaaagggctctattgaagaactgtgtcaaaaccaaactataaagaaagccatatta
gaagacatgcataaaattgggatagacggtggccttaaatcctttgaacaggtcaagtgc
atccatctacatccagagccattttccattgaaaatggactcttgacaccaaccttgaaa
gcaaagcggggagaccttgccaagcactttggaactcaaatcaagagtctgtatgagaac
acccaggagtag

DBGET integrated database retrieval system