KEGG   Bos taurus (cow): 514209Help
Entry
514209            CDS       T01008                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bta  Bos taurus (cow)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    514209 (ASNS)
Enzymes [BR:bta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     514209 (ASNS)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C44
   514209 (ASNS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKLQHHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVNLKHSMTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKHHHCRDEPLHALYDGVEKLFPGFEIETVKSNLRILFD
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVANHIGSEHHEVLFNSEEGIQVLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPDMRVPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFRILQDYIEHQVDDAAMASAAQKFPINTPKTKEGYYYRQIFENHYPGRADWLPHYWMPR
WTNATDPSARTLTHYKAAAKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatttgggcgctctttggcagcgatgactgcctttctgttcagtgtctgagt
gctatgaagattgcacacaggggtccggatgcattccgttttgaaaatgttaatgggtac
accaattgctgctttggatttcaccggttggcggtagttgaccagctgtttggaatgcag
ccaattcgagtgaagaaatatccttacttgtggctctgttacaacggtgaaatctacaac
cacaagaagctgcaacaccattttgaatttgaataccagaccaaagtggatggtgaaata
atccttcatctttatgacaaaggaggaattgaacaaacagtttgtatgttggatggagta
tttgcatttattttactggatactgccaataagaaagtgttcttgggcagagatacctat
ggagtgagacctttgtttaaagccatgacagaagatggatttttggccgtgtgttcagaa
gctaaaggactggttaacttgaagcactccatgactccttttttaaaagtggagcctttt
ctgccaggacattatgaagttttggacctaaagccaaatggcaaagtggcgtcggtggaa
atggtgaagcaccatcactgtagagacgagcctctgcatgccctgtatgacggcgtggag
aaactcttcccaggttttgagatagaaactgtgaagagcaacctccggattctttttgac
aatgccgttaagaaacgtttgatgacggacagaaggattggctgccttttatcaggtggc
ttggattccagtttggttgctgccactctgttgaagcagctaaaagaggcccaagttcag
taccctctccagacatttgcgattggcatggaagacagtcccgatttactagctgctaga
aaggtggcaaatcatattgggagcgaacaccatgaagtcctctttaactctgaggaaggc
attcaggtcctggatgaagtcatattttccttggaaacttatgatattacaacagtccgt
gcttcagtaggtatgtacttaatttctaagtacattcggaagaacacagatagcgtggtg
atcttctctggagaaggttcagatgaacttacgcagggttatatatattttcacaaggct
ccttccccggagaaagctgaggaggagagtgagcggcttctaagggaactctacttgttt
gatgttctccgagcagatcgaactactgcagcccatggccttgaattgagagtccctttc
ttggatcatcgcttttcttcctactacttgtctctgccaccagatatgagagttcccaag
aatgggatagaaaagcatctcctgagagagacatttgaggactccaatctgatacctaaa
gagattctctggcgaccaaaagaagccttcagtgatggaataacctcagttaaaaattcc
tggtttaggattttacaggactatattgaacatcaggttgatgatgcagcgatggcaagc
gcagcccagaaatttcccatcaatacccccaaaacaaaagaaggctattactaccgtcag
atctttgaaaaccactacccaggccgtgccgactggctgccccattactggatgcccagg
tggaccaacgccacggacccttctgcccgcactctgacccattacaaggccgctgccaaa
gcttag

DBGET integrated database retrieval system