KEGG   Bos taurus (cow): 514394Help
Entry
514394            CDS       T01008                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    514394 (UCHL1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     514394 (UCHL1)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   514394 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
6
AA seq 252 aa AA seqDB search
MQLKPMEINPEMLNKVLTRLGVAGQWRFEDVLGLEEESLGSVPAPACALLLLFPLTAQRC
FKLGREAASRFHHPDYPGRLFILLVSQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCG
TIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQ
CRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGTSSEDSLLQDAAKVCREFTEREQGE
VRFSAVALCKAA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaaaccaatggagattaaccccgagatgctgaacaaagtgctgacccggctg
ggggtcgccggccagtggcgcttcgaggatgttctgggactggaggaggagtctctgggc
tcggtgccagcgccggcctgcgcgctgctgctgctctttccgctcacggcgcagcgttgc
tttaaacttggaagagaagcagcatctcggttccatcatcctgattatccaggaagattg
ttcatcctactcgtgagtcagcatgagaacttcaggaaaaaacaaattgaagagctgaag
ggacaagaagtcagtcccaaggtgtacttcatgaagcagaccattggcaactcctgtgga
accatcggactcattcatgcagtggccaataatcaggacaaactggagttcgaggatggg
tctgttctgaaacagtttctttctgaaacagagaagttgtcccctgaagacagagcaaag
tgctttgaaaagaatgaggccattcaggcagcccacgatgccgtggcccaggaaggccaa
tgtcgggtagatgacaaagtgaacttccattttattctgtttaacaacgtggatggccac
ctctatgaacttgatggacggatgccttttccagtgaaccatggcaccagctcagaggac
tcgctgctgcaggacgctgccaaggtctgcagagaattcactgagcgtgagcagggggag
gtgcgcttctccgctgtggccctctgcaaggcggcctaa

DBGET integrated database retrieval system