KEGG   Bos taurus (cow): 514420Help
Entry
514420            CDS       T01008                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    514420 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    514420 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    514420 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    514420 (KAT2A)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     514420 (KAT2A)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     514420 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
19
AA seq 358 aa AA seqDB search
MAEPSQASTPAPAAQPRPLQSPAPTPTPTPTLSPASAPTPAPTPAPAPAPATAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctctaccccggcccctgccgcgcagccccgtccgcttcag
tccccagcccctaccccaactccgactcctaccctcagcccagcttcggccccgactccc
gctcccactccggcaccagcccctgccccagctacagccccagccgggagcacagggact
ggggggcccggggtaggaagtgggggtaccgggagcgggggtgatccggctcgacctggc
ctgagccagcagcagcgcgccagccaaaggaaagcgcaagtccgggggctgccgcgcgcc
aagaagctagagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggacctgcagcagccagcg
gcgaacctgagcgagctgtgccgcagctgtgagcaccctttggctgaccacgtgtcccac
ctggagaacgtgtcggaggatgagattaaccggctgctggggatggtggtggacgtggag
aatctgttcatgtctgttcacaaggaggaggacacggacaccaagcaggtctatttctac
ctcttcaagctcctgcggaaatgcatcctgcagatgacccggcctgtggtggagggatcc
ctgggcagccccccgtttgagaagcctaatattgagcagggtgtgctaaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacaatgttcgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacacctgcccaatttcggcagaggtct
caggctgaggatgtggctacctacaaggtcaattacaccagatggctctgctactgccac
gtgccccagagctgcgatagcctcccccggtatgagaccactcacgtctttgggcgcagc
cttctccgctccatcttcacggttacccggcgacagctgctagagaagttccgagtagag
aaggacaagctggtgcccgagaagaggaccctcatcctcacccacttccccaagtaa

DBGET integrated database retrieval system