KEGG   Bos taurus (cow): 514509Help
Entry
514509            CDS       T01008                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bta  Bos taurus (cow)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    514509 (AGMAT)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     514509 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
16
AA seq 361 aa AA seqDB search
MLRLLASTCARGLGGRGGSRRLVSRGRARPVAGLCDPSRRLSRQASDAPRNQPPSPEFVA
RSVGICSMMRLPVQATPEGLDAAFVGVPLDIGTSNRPGARFGPRRIREESVLLRTTNPST
GAVPFQFLRVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDHTITYPILQA
IAEKHGPVGLVHVDAHMDMADKALGEKLYHGTPFRRCVDEGLLDCKRVVQIGIRGSSTTL
DTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLDPAYAPGTGTP
EIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFEMLCVLPKVTV
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgctggcgtccacctgcgccaggggcctggggggtcgcgggggctcgcgg
aggctggtttcccggggccgagcgcgtccagtcgcgggactctgcgaccccagccgccgc
ttgagccgccaggcttccgacgccccccggaaccaaccccctagtcccgagttcgtggcc
cggtcggtgggcatctgctccatgatgcggctgccggtgcaggccactccagaggggctg
gacgccgccttcgtcggggtaccgctggacattgggacctccaaccggcctggggcgaga
tttggaccccgacggatccgagaagaatcggtgctgcttaggaccaccaatcctagcaca
ggagctgttcccttccagttccttagggttgcagacctaggcgacgtgaatgtcaatctt
tacaaccttcaggacagctgccgcctgattcgagcggactatcagaaaatcgtagcagcc
ggctgtgttcctctgaccttgggtggagatcatacaatcacctatcctatattgcaagcg
atagcagaaaagcatggtcctgtggggctggtgcacgtggacgctcacatggacatggct
gacaaggccctcggggagaagctctatcacgggacccccttccgccggtgcgtggatgag
ggactcctggactgcaagcgtgtggtgcagatcggcatccggggttcttccacgaccttg
gatacctacagatacagccggagccagggcttccgggtggtcctggctgaagactgctgg
ctgaagtcactggttcctttgatgggggaagtgaggcagcagatgggaggcagacccatt
tatatcagctttgatattgatggcttggaccctgcttacgccccaggcacagggacacct
gaaattgctggtcttactcctagtcaggctctggagatcatccggggttgtcaaggcctg
aatgtggtgggttgtgacctcgtggaagtttcaccaccctacgatccttctggaaacaca
gctctggtggcggctaacctgctgtttgagatgctgtgtgttctccccaaagtgacagtc
gcctga

DBGET integrated database retrieval system