KEGG   Bos taurus (cow): 514745Help
Entry
514745            CDS       T01008                                 

Gene name
DHCR7
Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
bta  Bos taurus (cow)
Pathway
bta00100  Steroid biosynthesis
bta01100  Metabolic pathways
Module
bta_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    514745 (DHCR7)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     514745 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24
Motif
Other DBs
NCBI-GeneID: 514745
NCBI-ProteinID: NP_001014927
BGD-bta: BT23247
Ensembl: ENSBTAG00000016465
UniProt: Q5E9J5
Position
29
AA seq 475 aa AA seqDB search
MAAKSQPSAPKTKSTSGLTNGNAAAQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYGCSLTVPVADLATGRARLADIWARTPPVTAKAAQIYTAWVTLQVLLYMLLPDFCHK
FLPGYVGGVQEGAVTPAGAVNKYEINGLQAWLLTHLLWFANAHLLGWFSPTIIFDNWIPL
LWCANILGYTVSTFAMVKGYLFPTDARECKFTGNFFYNYMMGVEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQQELYGHVTNSMVLVNILQAIYVLDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLPTYYALGVLLLGLLGYYIFRMTNHQKDL
FRRTDGRCLIWGRKPKAIECSYTSADGQRHHSKLLVSGFWGVARHFNYTGDLMGSLAYCL
ACGGGHLLPYFYIIFMAILLTHRCLRDEHRCANKYGRDWEHYTAAVPYRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaagtcccagcccagcgcccctaaaaccaagagcaccagcggcctcaccaac
ggcaacgctgcagcccaaggccagtggggccgagcctgggaggtggactggttttccctg
gcgagcgtcatcttcctgctgctgtttgcgcccttcatcgtgtactacttcatcatggcc
tgcgaccagtacggctgctccctgacagtgcccgtggcggacctcgccactgggcgggct
cggctcgccgacatctgggccaggacgccgcccgtgaccgcaaaggcggcccagatctac
acagcatgggtcacgctccaggtgcttctgtacatgctgcttcctgacttctgccacaag
tttcttccgggctacgtggggggcgttcaggagggcgccgtgactcccgcaggagccgtc
aacaagtatgagatcaacggcctgcaggcctggctcctcacgcacctcctgtggttcgcc
aacgcccacctcctcggctggttctcccccaccatcattttcgacaactggatcccgctg
ctctggtgtgccaacatcctgggctacaccgtctccaccttcgccatggtcaagggctac
ctcttccccactgacgcccgggaatgcaaattcacgggcaatttcttttacaactacatg
atgggcgttgagtttaacccccgaattgggaagtggtttgacttcaagctcttcttcaat
ggacgccccgggatcgtcgcctggaccctcatcaacctgtcctttgcagccaagcagcag
gagctctacggccacgtgaccaactccatggtcttggtcaacatcctgcaggccatctac
gtgctggacttcttctggaacgaaacctggtacctgaaaaccatcgacatctgccacgac
cactttgggtggtacctgggctggggggactgcgtctggctgccatacctgtacacgctg
cagggcctgtacctggtgtaccaccccgtgcagctgcccacctactacgcgctgggcgtc
ctgctcctgggcctgctcggctactacatcttccggatgaccaaccaccagaaggacctc
ttccgccgcacggacgggcgctgcctgatctggggcaggaagcccaaggccatcgagtgc
tcctacacatcagccgacgggcagagacaccacagcaagctgctggtctcgggcttctgg
ggcgtggcccgccacttcaactacacgggtgacctgatgggcagcctggcgtactgcctg
gcctgcggcggcggccacctcctgccctacttctacatcatcttcatggccatcctgctg
acccaccgctgcctccgggacgagcaccgctgtgccaacaagtacggccgcgactgggag
cactacacggccgccgtgccgtaccgcctgctccctggcatcttctag

DBGET integrated database retrieval system