KEGG   Bos taurus (cow): 514813Help
Entry
514813            CDS       T01008                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bta04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:bta05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 1137 aa AA seqDB search
MCLGLITVGSFKKRMLSESSWRFYAVTLMWLREPCPPLPPPQQILLQSHADMAGNCALGP
EAGDTDDPPRITQNPVINGNVAMSDGHSNTEEDMEDDTSWRSEATFQFTVERFSRLSESV
LSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRD
DEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW
DSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFY
ELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFR
GKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHG
LQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDP
ANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDL
SVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYM
QVQIVAEDQFCGHQGNDMYDEEKVRYTVFKVLKNSSLSEFVQNLSQTMGFPQDQIRLWPM
QARSNGTKRPAMLDNEADGSKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDV
MLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTER
IQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPN
DPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLL
QFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEEC
KKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKE
NEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMM
GRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctgggcctgataactgtgggcagctttaaaaagagaatgctgagcgagagctcc
tggaggttctatgcagtcactctgatgtggctgagagaaccctgccctcccctcccccca
ccccagcagattctgctgcagagccatgcagacatggcggggaactgcgcacttggacca
gaagctggagatacagatgacccaccgagaattacccaaaaccctgtaatcaacgggaat
gtggccatgagtgacgggcacagcaacacggaggaggacatggaggacgacacgagttgg
cgctccgaggcaacctttcagttcactgtcgagcgcttcagcagactgagtgagtcggtc
cttagccctccgtgttttgtgcgaaatctgccgtggaagattatggtgatgccacgcttt
tatccagacagaccacaccaaaaaagcgtaggattctttctccagtgcaatgctgaatct
gattccacgtcttggtcctgtcacgcgcaggcggtgctgaagatcatcaactacagagat
gacgagaagtcgttcagccggcgcatcagtcacttgttcttccataaagagaacgactgg
ggattttccaatttcatggcctggagcgaagtgactgatcctgagaaaggatttattgat
gatgacaaagttacttttgaagtctttgtacaggcggacgccccccatggagttgcgtgg
gactcaaagaagcacacgggctacgtcggcttaaagaatcagggagcgacttgctacatg
aacagcctgctgcagactttatttttcacaaaccagctacgcaaggcggtgtacatgatg
ccaacagagggcgacgattcatccaaaagtgtccctttagcattgcaaagagtgttctac
gagttacagcacagcgataagcccgtaggaacaaagaagctgaccaagtcattcgggtgg
gaaacgttagatagcttcatgcaacacgatgttcaagagctctgtcgagtgttgcttgat
aatgtggaaaacaagatgaaaggcacatgtgtagaaggcaccatacctaaattattcaga
ggcaagatggtgtcttatatccagtgtaaagaagtagactaccgatctgatagaagagaa
gattattatgatatccagctaagtataaaaggaaagaaaaatatatttgaatcgtttgtg
gactacgtggcggtagaacagctggacggggacaataaatacgacgccggggagcacggc
ctgcaggaggcagaaaaaggagtgaaattcctgacgttgccaccagtgttacatctgcaa
ctgatgcgatttatgtatgatcctcagacggaccaaaacatcaagatcaatgacaggttt
gaattccctgaacagttaccacttgatgaatttttgcaaaaaactgatcctaaagaccct
gcaaattacattcttcatgcggtcctagttcatagtggagataatcatggtggacattat
gtggtttatctcaaccccaaaggggatggcaaatggtgtaagtttgacgacgacgtggtg
tccaggtgcacgaaggaggaagccatcgagcacaactacgggggccacgacgacgacctg
tccgtgcggcactgcaccaacgcctacatgctggtctacatccgcgagtccaagctcagt
gaggttttacaagctgtcaccgaccaggacatccctcagcagttggtggaacgattgcag
gaggagaagaggatcgaggcgcagaagcggaaggagcggcaggaggcccatctctacatg
caagtgcagattgtcgcagaggaccagttttgtggccatcaagggaatgatatgtacgat
gaagaaaaagtgagatacactgtgttcaaagtgctgaaaaactcctcgctttcggagttt
gtccagaacctctctcagaccatgggattcccgcaagatcagattcggttgtggcccatg
caggcgaggagcaacggcaccaagcggccagccatgctggacaacgaggccgacggcagc
aagacgatgattgagctcagtgataatgaaaacccctggacgatattcctggaaacagtt
gatccggagctagctgctagtggagccacgctacccaagtttgataaagatcatgatgtg
atgttatttttgaagatgtacgatcccaaaacacggagcttgaattactgtgggcatatc
tacacaccaatatcctgtaaaatacgtgacttgctcccggttatgtgtgacagagcagga
tttatccaggatactagccttatcctctatgaggaagttaaaccgaatttaacagagaga
attcaggactacgatgtgtctcttgacaaagccctcgatgagctaatggatggtgacatt
atagtgtttcagaaggatgaccccgaaaacgataacagtgaattacccactgcaaaggaa
tacttccgagacctctaccaccgtgtcgatgtgattttctgtgataaaacgatccccaac
gatcccggattcgtggtgacgctgtcaaacaggatgaattatttccaggtggcaaagacg
gtcgcccagaggctcaacaccgacccgatgctgctccagttcttcaagtctcaaggttac
agggatggcccgggcaaccctctgagacataattatgaagggactctgagagacctgcta
cagttcttcaagcccaggcagcccaagaaactgtactaccagcagcttaagatgaaaatc
acagactttgagaacaggcgaagttttaagtgtatatggttaaacagccaatttagggaa
gaggaaataacactatatccagacaagcacgggtgcgtccgggacctgttagaggaatgt
aaaaaggctgtggagctcggcgagaaggcatcagggaaacttaggctgctagaaattgta
agctacaaaattattggtgtgcatcaagaagatgaactattagaatgtttatctcctgcg
acgagtcgaacgtttcgaatagaggaaatacctttggaccaggtagacatcgacaaggag
aatgagatgctcatcacggtggctcatttccacaaggaggtgttcgggacgttcgggatc
ccgttcttgctgaggatacaccagggcgagcatttcagagaagtgatgaagcggattcag
agtctgctggacatccaggaaaaggagtttgaaaagtttaaatttgcaattgtgatgatg
ggccgacatcagtacataaatgaagatgagtatgaagtgaacttgaaagactttgaacct
cagcctggtaacatgtctcaccctcggccgtggctcgggctcgaccacttcaacaaagcc
ccgaagaggagtcgctacacataccttgaaaaggccatcaaaatccataactga

DBGET integrated database retrieval system