KEGG   Bos taurus (cow): 514813Help
Entry
514813            CDS       T01008                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    514813 (USP7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    514813 (USP7)
  Infectious diseases
   05168 Herpes simplex infection
    514813 (USP7)
   05169 Epstein-Barr virus infection
    514813 (USP7)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     514813 (USP7)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   514813 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 1137 aa AA seqDB search
MCLGLITVGSFKKRMLSESSWRFYAVTLMWLREPCPPLPPPQQILLQSHADMAGNCALGP
EAGDTDDPPRITQNPVINGNVAMSDGHSNTEEDMEDDTSWRSEATFQFTVERFSRLSESV
LSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRD
DEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW
DSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFY
ELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFR
GKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHG
LQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDP
ANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDL
SVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYM
QVQIVAEDQFCGHQGNDMYDEEKVRYTVFKVLKNSSLSEFVQNLSQTMGFPQDQIRLWPM
QARSNGTKRPAMLDNEADGSKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDV
MLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTER
IQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPN
DPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLL
QFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEEC
KKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKE
NEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMM
GRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctgggcctgataactgtgggcagctttaaaaagagaatgctgagcgagagctcc
tggaggttctatgcagtcactctgatgtggctgagagaaccctgccctcccctcccccca
ccccagcagattctgctgcagagccatgcagacatggcggggaactgcgcacttggacca
gaagctggagatacagatgacccaccgagaattacccaaaaccctgtaatcaacgggaat
gtggccatgagtgacgggcacagcaacacggaggaggacatggaggacgacacgagttgg
cgctccgaggcaacctttcagttcactgtcgagcgcttcagcagactgagtgagtcggtc
cttagccctccgtgttttgtgcgaaatctgccgtggaagattatggtgatgccacgcttt
tatccagacagaccacaccaaaaaagcgtaggattctttctccagtgcaatgctgaatct
gattccacgtcttggtcctgtcacgcgcaggcggtgctgaagatcatcaactacagagat
gacgagaagtcgttcagccggcgcatcagtcacttgttcttccataaagagaacgactgg
ggattttccaatttcatggcctggagcgaagtgactgatcctgagaaaggatttattgat
gatgacaaagttacttttgaagtctttgtacaggcggacgccccccatggagttgcgtgg
gactcaaagaagcacacgggctacgtcggcttaaagaatcagggagcgacttgctacatg
aacagcctgctgcagactttatttttcacaaaccagctacgcaaggcggtgtacatgatg
ccaacagagggcgacgattcatccaaaagtgtccctttagcattgcaaagagtgttctac
gagttacagcacagcgataagcccgtaggaacaaagaagctgaccaagtcattcgggtgg
gaaacgttagatagcttcatgcaacacgatgttcaagagctctgtcgagtgttgcttgat
aatgtggaaaacaagatgaaaggcacatgtgtagaaggcaccatacctaaattattcaga
ggcaagatggtgtcttatatccagtgtaaagaagtagactaccgatctgatagaagagaa
gattattatgatatccagctaagtataaaaggaaagaaaaatatatttgaatcgtttgtg
gactacgtggcggtagaacagctggacggggacaataaatacgacgccggggagcacggc
ctgcaggaggcagaaaaaggagtgaaattcctgacgttgccaccagtgttacatctgcaa
ctgatgcgatttatgtatgatcctcagacggaccaaaacatcaagatcaatgacaggttt
gaattccctgaacagttaccacttgatgaatttttgcaaaaaactgatcctaaagaccct
gcaaattacattcttcatgcggtcctagttcatagtggagataatcatggtggacattat
gtggtttatctcaaccccaaaggggatggcaaatggtgtaagtttgacgacgacgtggtg
tccaggtgcacgaaggaggaagccatcgagcacaactacgggggccacgacgacgacctg
tccgtgcggcactgcaccaacgcctacatgctggtctacatccgcgagtccaagctcagt
gaggttttacaagctgtcaccgaccaggacatccctcagcagttggtggaacgattgcag
gaggagaagaggatcgaggcgcagaagcggaaggagcggcaggaggcccatctctacatg
caagtgcagattgtcgcagaggaccagttttgtggccatcaagggaatgatatgtacgat
gaagaaaaagtgagatacactgtgttcaaagtgctgaaaaactcctcgctttcggagttt
gtccagaacctctctcagaccatgggattcccgcaagatcagattcggttgtggcccatg
caggcgaggagcaacggcaccaagcggccagccatgctggacaacgaggccgacggcagc
aagacgatgattgagctcagtgataatgaaaacccctggacgatattcctggaaacagtt
gatccggagctagctgctagtggagccacgctacccaagtttgataaagatcatgatgtg
atgttatttttgaagatgtacgatcccaaaacacggagcttgaattactgtgggcatatc
tacacaccaatatcctgtaaaatacgtgacttgctcccggttatgtgtgacagagcagga
tttatccaggatactagccttatcctctatgaggaagttaaaccgaatttaacagagaga
attcaggactacgatgtgtctcttgacaaagccctcgatgagctaatggatggtgacatt
atagtgtttcagaaggatgaccccgaaaacgataacagtgaattacccactgcaaaggaa
tacttccgagacctctaccaccgtgtcgatgtgattttctgtgataaaacgatccccaac
gatcccggattcgtggtgacgctgtcaaacaggatgaattatttccaggtggcaaagacg
gtcgcccagaggctcaacaccgacccgatgctgctccagttcttcaagtctcaaggttac
agggatggcccgggcaaccctctgagacataattatgaagggactctgagagacctgcta
cagttcttcaagcccaggcagcccaagaaactgtactaccagcagcttaagatgaaaatc
acagactttgagaacaggcgaagttttaagtgtatatggttaaacagccaatttagggaa
gaggaaataacactatatccagacaagcacgggtgcgtccgggacctgttagaggaatgt
aaaaaggctgtggagctcggcgagaaggcatcagggaaacttaggctgctagaaattgta
agctacaaaattattggtgtgcatcaagaagatgaactattagaatgtttatctcctgcg
acgagtcgaacgtttcgaatagaggaaatacctttggaccaggtagacatcgacaaggag
aatgagatgctcatcacggtggctcatttccacaaggaggtgttcgggacgttcgggatc
ccgttcttgctgaggatacaccagggcgagcatttcagagaagtgatgaagcggattcag
agtctgctggacatccaggaaaaggagtttgaaaagtttaaatttgcaattgtgatgatg
ggccgacatcagtacataaatgaagatgagtatgaagtgaacttgaaagactttgaacct
cagcctggtaacatgtctcaccctcggccgtggctcgggctcgaccacttcaacaaagcc
ccgaagaggagtcgctacacataccttgaaaaggccatcaaaatccataactga

DBGET integrated database retrieval system