KEGG   Bos taurus (cow): 514865Help
Entry
514865            CDS       T01008                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
bta  Bos taurus (cow)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bta00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 349 aa AA seqDB search
FSIQCFFTRGGLSNMLFQCSLPDTLATVGDEPRKVLLRLYGAILKMRSCNKEGSEQAQKD
SEFQGAEAMVLESVMFAILAERSLGPKLFGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
AEKMARFHGMKMPFNKEPKWLFGTMEKYLNQVLRIRFTGESKVKQLHRFLSYNLPLELEN
LRSLLESTPSPVVFCHNDCQEGNILLLDGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFC
EWMYDYNYEKYPFFRANILKYPTRKQQLHFISNYLAAFQNEFENLSNEEKSVIEEEMLLE
VNRFALASHFFWGLWSIVQAKISSIEFGYMEYAQARFDAYFDQKRKLGV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttctctattcagtgttttttcacaagaggtggcctcagcaacatgctgttccagtgctcc
ttgcccgacaccctggccaccgtcggagacgagcctcggaaggtgctcctgaggctgtac
ggggcgatcctgaagatgcggtcctgtaataaggagggatccgaacaagctcagaaagac
agtgaatttcaaggcgccgaggccatggtcctggagagcgtcatgtttgccattctcgcc
gagaggtcgctggggccgaagctctttggcatcttcccccaaggccgcctggagcagttc
atcccgagccggcgattagacactgaagaattaagtttgccagatatttctgcagaaata
gctgagaaaatggccagatttcatggtatgaaaatgccattcaataaggaaccaaaatgg
ctctttggaacaatggaaaaatacctgaatcaagtgctgagaattaggtttaccggggag
tccaaagtgaagcagctgcacaggttcctcagttacaacctgcctttggagctagaaaac
ctgaggtcattgcttgaatccactccatctcccgtcgtgttctgtcacaatgactgtcag
gaaggtaacatcttactgctggatggcagggagaattcggaaaaacagaaactcatgctc
atcgactttgaatacagcagttacaactataggggattcgacattgggaatcatttctgt
gaatggatgtatgattataattatgaaaagtacccttttttcagagcaaacatcctgaag
taccccaccaggaaacaacagctccattttatttccaattacttggctgcattccaaaat
gaatttgaaaacctcagtaacgaagaaaagtctgttatagaagaagaaatgctgcttgaa
gtcaataggtttgccctcgcgtcccatttcttctggggactctggtcaatcgttcaggcc
aagatttcctccattgaatttgggtacatggagtacgcccaagccaggtttgatgcctac
ttcgaccagaagaggaagctcggggtgtga

DBGET integrated database retrieval system