KEGG   Bos taurus (cow): 514971Help
Entry
514971            CDS       T01008                                 

Gene name
CYP2S1
Definition
cytochrome P450, family 2, subfamily S, polypeptide 1 (EC:1.14.14.1)
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:bta00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:bta00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
18
AA seq 494 aa AA seqDB search
MEAAGTWALLLLLLLLVVTLVLPATWDRGHLPPGPTPLPLLGNLLQLRPGALYLGLLRLS
KKYGPVFTVYLGPWRRVVVLVGHEAVQEALGGQAEEFSGRGTVATLDGTFDSHGVFFSNG
ERWRQLRKFTTLALRDLGMGKREGEELIQAEARCLVEALQGTKGRPFDPSLLLAQATCNI
ICSLVFDLRLPYDNEEFQAVVRAAGGIAVGVSSPWGQTYEMFSRFLQRLPGPHTQLLRHL
GTVAAFAAQQVWQHKGSLGTSGPVRDLVDAFLLKMAKEKQDPNTEFTAKNLLMTVVYLLF
AGTVTVSTTIRYTLLLLLKYPQVQERVQEELMRELGAGQRPSLGDRARLPYTDAVLHEAQ
RLLALVPMGIPRALTKTTRFRGYTLPQGTEVFPLLGSILHDPAVFEEPKEFNPGRFLDAD
GKFKKHEAFLPFSLGKRVCLGEGLARTELFLLFTAILQAFSLEGPCPLGALSLQPAISGL
FNIPQAFQLQFRPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgggcacctgggctctgctgctgctgcttctcctcctggtggtgacgctg
gtgctgcctgcgacctgggaccgaggccacctgcccccggggcccacgccgctgccgctg
ctgggcaacctcctgcagctccggcccggggcgctctacctggggctcctgcggctgagt
aagaagtacggaccagtgttcaccgtgtacctgggaccctggcggcgcgtggtggtcctg
gttgggcatgaggctgtgcaggaggccctgggaggtcaggccgaggagttcagcgggcgg
gggacggtggcaacgctggacgggacctttgatagccacggggtgttcttctccaacggg
gagcgatggaggcagctgaggaagttcaccacactggccctgcgggacctaggcatgggg
aagcgagaaggcgaggagctgatccaggcggaggcccgctgtctggtggaggcgctgcag
gggacaaaaggacggccgtttgacccctccctgctgctggcccaggccacctgcaacatc
atctgctccctagtcttcgacctccgcctcccctacgacaatgaggagttccaggctgtg
gtccgggcggctggcggcatcgccgtgggggtcagctccccgtggggccagacctacgag
atgttctcccggttcctacagcgcctcccgggcccccacacgcagctcctccgccacttg
ggcaccgtggccgccttcgccgcccagcaggtgtggcagcacaaggggagcctgggcacc
tcaggccctgtgcgcgatctcgtggacgccttcctgctgaagatggcaaaggagaagcaa
gacccaaacacagaattcaccgccaagaacctgctgatgacggtcgtgtatctgctgttt
gccgggacagtgacggtcagcaccacgatccgctacaccctgctgctcctgctgaaatac
cctcaggtccaagagcgtgtgcaggaggagctgatgcgagagctgggggccggccagagg
ccaagcctgggggaccgagcccgcctcccctacacggatgcagttctgcatgaggcgcag
cggctgctggcgctggtacccatgggaataccccgagccctcaccaagaccacccgcttc
cgggggtacaccctgccacagggcacagaggtcttcccccttcttggctccatcctgcat
gaccccgccgtctttgaagagcccaaggagttcaacccaggccgattcctggacgcggat
gggaagttcaagaagcacgaggcgttcctgcccttctccttaggtaagcgtgtctgcctc
ggggagggcctggctcggaccgaactcttcctcctgttcaccgccatcctgcaggccttc
tcactggagggcccgtgcccgctgggcgccctgagcctccagccggccatcagtggcctt
ttcaacatcccccaagccttccagctgcaattccggccccggtga

DBGET integrated database retrieval system