KEGG   Bos taurus (cow): 514971Help
Entry
514971            CDS       T01008                                 

Gene name
CYP2S1
Definition
cytochrome P450, family 2, subfamily S, polypeptide 1 (EC:1.14.14.1)
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    514971 (CYP2S1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    514971 (CYP2S1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     514971 (CYP2S1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   514971 (CYP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 494 aa AA seqDB search
MEAAGTWALLLLLLLLVVTLVLPATWDRGHLPPGPTPLPLLGNLLQLRPGALYLGLLRLS
KKYGPVFTVYLGPWRRVVVLVGHEAVQEALGGQAEEFSGRGTVATLDGTFDSHGVFFSNG
ERWRQLRKFTTLALRDLGMGKREGEELIQAEARCLVEALQGTKGRPFDPSLLLAQATCNI
ICSLVFDLRLPYDNEEFQAVVRAAGGIAVGVSSPWGQTYEMFSRFLQRLPGPHTQLLRHL
GTVAAFAAQQVWQHKGSLGTSGPVRDLVDAFLLKMAKEKQDPNTEFTAKNLLMTVVYLLF
AGTVTVSTTIRYTLLLLLKYPQVQERVQEELMRELGAGQRPSLGDRARLPYTDAVLHEAQ
RLLALVPMGIPRALTKTTRFRGYTLPQGTEVFPLLGSILHDPAVFEEPKEFNPGRFLDAD
GKFKKHEAFLPFSLGKRVCLGEGLARTELFLLFTAILQAFSLEGPCPLGALSLQPAISGL
FNIPQAFQLQFRPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgggcacctgggctctgctgctgctgcttctcctcctggtggtgacgctg
gtgctgcctgcgacctgggaccgaggccacctgcccccggggcccacgccgctgccgctg
ctgggcaacctcctgcagctccggcccggggcgctctacctggggctcctgcggctgagt
aagaagtacggaccagtgttcaccgtgtacctgggaccctggcggcgcgtggtggtcctg
gttgggcatgaggctgtgcaggaggccctgggaggtcaggccgaggagttcagcgggcgg
gggacggtggcaacgctggacgggacctttgatagccacggggtgttcttctccaacggg
gagcgatggaggcagctgaggaagttcaccacactggccctgcgggacctaggcatgggg
aagcgagaaggcgaggagctgatccaggcggaggcccgctgtctggtggaggcgctgcag
gggacaaaaggacggccgtttgacccctccctgctgctggcccaggccacctgcaacatc
atctgctccctagtcttcgacctccgcctcccctacgacaatgaggagttccaggctgtg
gtccgggcggctggcggcatcgccgtgggggtcagctccccgtggggccagacctacgag
atgttctcccggttcctacagcgcctcccgggcccccacacgcagctcctccgccacttg
ggcaccgtggccgccttcgccgcccagcaggtgtggcagcacaaggggagcctgggcacc
tcaggccctgtgcgcgatctcgtggacgccttcctgctgaagatggcaaaggagaagcaa
gacccaaacacagaattcaccgccaagaacctgctgatgacggtcgtgtatctgctgttt
gccgggacagtgacggtcagcaccacgatccgctacaccctgctgctcctgctgaaatac
cctcaggtccaagagcgtgtgcaggaggagctgatgcgagagctgggggccggccagagg
ccaagcctgggggaccgagcccgcctcccctacacggatgcagttctgcatgaggcgcag
cggctgctggcgctggtacccatgggaataccccgagccctcaccaagaccacccgcttc
cgggggtacaccctgccacagggcacagaggtcttcccccttcttggctccatcctgcat
gaccccgccgtctttgaagagcccaaggagttcaacccaggccgattcctggacgcggat
gggaagttcaagaagcacgaggcgttcctgcccttctccttaggtaagcgtgtctgcctc
ggggagggcctggctcggaccgaactcttcctcctgttcaccgccatcctgcaggccttc
tcactggagggcccgtgcccgctgggcgccctgagcctccagccggccatcagtggcctt
ttcaacatcccccaagccttccagctgcaattccggccccggtga

DBGET integrated database retrieval system