KEGG   Bos taurus (cow): 515067Help
Entry
515067            CDS       T01008                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    515067 (PGAM2)
   01230 Biosynthesis of amino acids
    515067 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    515067 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    515067 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    515067 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    515067 (PGAM2)
Enzymes [BR:bta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     515067 (PGAM2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   515067 (PGAM2)
  Exosomal proteins of melanoma cells
   515067 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 253 aa AA seqDB search
MSTHRLVMVRHGESTWNQENRFCGWFDAELSEKGAEEAKKAAQAIKDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYKSISKERRYAGLKAGELPTCESLKDTIARALPFWNDEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQALKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctacccaccgccttgtgatggttcggcatggtgagagcacctggaaccaggagaat
cgcttctgtggttggttcgatgcagagctgagcgagaagggggctgaggaggccaagaag
gcggcccaggccatcaaggacgcaaagatggaatttgacatctgctacacatcggtgctg
aagcgggccatacgcaccctctggaccatcctggatgggacggaccaaatgtggctgcct
gtggtgcgtacctggcgcctcaacgagcggcactatgggggtctcactggcctcaacaag
gcagagacggctgcaaagcacggggaggagcaggtgaagatctggaggcgctcctttgac
atcccaccaccccccatggatgagaaacacccctactacaagtccatcagcaaggagcgt
cggtatgcaggcctgaaagctggggaactgcccacgtgtgagagcctcaaggacaccatt
gcacgggccctgcccttctggaatgatgagatcgcccctcagatcaaggctggcaagaga
gtgctcattgcagcccacgggaacagcctacggggaatcgtcaagcacctggaagggatg
tcggaccaggccatcatggagctgaacctgcccacggggatccccattgtgtacgaactg
gaccaggcactgaagcccaccaagcccatgcgcttcctgggggacgaggagaccgtgcgc
aaggccatggaagctgtggctgctcagggaaaggctaagtga

DBGET integrated database retrieval system