KEGG   Bos taurus (cow): 515202Help
Entry
515202            CDS       T01008                                 

Gene name
USP18, bubp43
Definition
ubiquitin specific peptidase 18 (EC:3.1.2.-)
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 321 aa AA seqDB search
MGPVGLHNIGQTCCLNSLIQVLVRNVGFAKILKRITVPGGAEEQRRSVPFQLLLLLEKMQ
DSRKKAVQPTELAYCLQKYNIPMFVQHDAAQLYLTVWNLIKNQITDVDLVARLQALYTIR
LKESFVCLECTSEMSRNSSMLALPLSVFDMHWKPLKTLEDALHCFFQPQELSSKDKCFCE
SCGRKTLWKQVLTLTHLPQTLTIHLMRFSIRNLRAEKVCHSLYFPQNLDLTKLLETKGEP
CSAEEQCGGHYELFAVIAHVGNADYGHYCAYIRSSEDGEWFCFNDSNVSWVSWEDVQCTY
GNHSYRWRETAYLLFYVKTES
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggtcggtttacacaacattggacagacatgctgtcttaactccctgatccag
gtgcttgttagaaatgtgggatttgccaagatactgaagaggataacggtgccaggcgga
gctgaggagcagaggaggagtgtccccttccagctgctcttgctgctggagaagatgcag
gacagccggaagaaggcggtgcagcccacggagctggcctactgtctgcagaagtacaac
attccgatgtttgtccagcatgatgctgcccagctctacctcacagtctggaacctgatc
aagaaccagatcacagacgtggacttggtggcaaggctgcaagccctctacaccatccgg
ttgaaggagtcctttgtctgtcttgaatgtacctcggagatgagcagaaacagcagcatg
ctggccctccccctgtctgtctttgatatgcactggaagcccctgaaaacgctggaggat
gctctccactgtttcttccagccccaggagctgtccagcaaagacaagtgcttctgtgag
agctgtggcaggaagactctctggaagcaggtcttgacactgacccatctgccccagaca
ctgaccatccacctcatgagattctccatcagaaacctgcgggcagaaaaagtctgccac
tcattgtatttcccccagaatctggatctaaccaagctccttgagacaaagggagagccc
tgcagtgctgaggagcagtgtggagggcactatgagctctttgctgtgatcgcccacgtg
gggaacgctgactatggtcactactgtgcctacatccggagttctgaagatggagaatgg
ttctgcttcaacgactccaatgtttcttgggtgtcctgggaagacgtccagtgtacctat
gggaatcacagctaccgctggcgggagactgcctatctcctgttttacgtgaagactgag
tcctaa

DBGET integrated database retrieval system