KEGG   Bos taurus (cow): 515270Help
Entry
515270            CDS       T01008                                 

Gene name
GAMT
Definition
guanidinoacetate N-methyltransferase (EC:2.1.1.2)
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
bta  Bos taurus (cow)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    515270 (GAMT)
   00330 Arginine and proline metabolism
    515270 (GAMT)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     515270 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 236 aa AA seqDB search
MSAPAATPIFAPGENCSPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAAAASR
GGRVLEVGFGMAIAATKVQEAPIEEHWIIECNEGVFQRLQDWALQQPHKVVPLKGLWEEV
APTLPDSHFDGILYDTYPLSEETWHTHQFNFIRDHAFRLLKPGGVLTYCNLTSWGELMKT
KYSDITTMFEETQVPALLEAGFRRDNIRTQVMELVPPANCRYYAFPRMITPLVTKH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccgccgcgaccccaatcttcgcgcccggcgagaactgcagccccgcatgg
cgggctgcgcccgcggcctacgacgcgtcggacacgcacctgcagatcctgggcaagccg
gtgatggagcgctgggagaccccctacatgcacgcgctggcggccgccgccgcctccaga
gggggccgggtgctagaagtgggcttcggcatggccatcgcagccacaaaggtgcaggag
gctcccatcgaggagcactggattattgagtgcaacgagggcgtcttccagcggctccag
gattgggccctgcagcagccacacaaggtggttcccttgaaaggcctgtgggaggaggtg
gcacccaccctgccagacagtcactttgatgggatcctgtacgatacatacccgctgtcg
gaggagacctggcacactcaccagttcaacttcattcgggaccatgccttccgcctgctg
aagccagggggtgtcctcacctactgtaacctcacctcctggggagagctaatgaagacc
aagtattcagacatcaccaccatgtttgaggagacccaggtgccggccctgctggaggcg
ggcttccggcgggataacatccgcacacaggtcatggagctggtcccaccagccaactgc
cgctactacgccttcccgcggatgatcacgcccctggtcaccaagcactga

DBGET integrated database retrieval system