KEGG   Bos taurus (cow): 515280Help
Entry
515280            CDS       T01008                                 

Gene name
CHP2
Definition
calcineurin B homologous protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
bta  Bos taurus (cow)
Brite
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     515280 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 196 aa AA seqDB search
MGSRSSHAARIPDVDSLRQETGFSQASLRRLYDRFNALDRTGKGYLSRMDLQQIGALAVN
PLGDRIIDSFFPDGSLRLDFPGFVRVLAHFRPVDEEDDGNRDPKEPEPLNSRMNKLRFAF
QLYDLDRDGKISRHEMLQALRLMVGVQVTEEQLESIADRTVQEADEDGDGAVSFLEFAKS
LEKMNIEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccgcagctcccacgccgccaggatccccgacgtggacagcctccggcaggag
accggcttctcgcaggccagtctgcgccgcctctacgaccgattcaacgctctggatagg
accggcaagggctacctgagccgcatggatctgcagcagatcggggcgctggccgtgaac
cccctgggcgaccgcattatagacagcttcttcccagacgggagtctgcgactggacttt
ccaggctttgtcagagtcctggctcattttcgacctgtggatgaagaggacgatggaaac
cgggaccccaaggaacccgagcccctcaacagcagaatgaacaaacttcgctttgccttt
cagctctacgacttggatcgagatggaaagatctccaggcatgagatgctgcaggcactc
cgactgatggttggggtacaggtgacagaagagcagctggagagcatcgccgaccgcaca
gtgcaggaagcggatgaagatggggatggagctgtgtccttcctggagtttgccaagtcc
ttagaaaagatgaacatcgaacagaaaatgagcatccggattctgaagtga

DBGET integrated database retrieval system