KEGG   Bos taurus (cow): 515321Help
Entry
515321            CDS       T01008                                 

Gene name
BDH2, DHRS6
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase 2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bta  Bos taurus (cow)
Pathway
bta00072  Synthesis and degradation of ketone bodies
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    515321 (BDH2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    515321 (BDH2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     515321 (BDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR ADH_zinc_N AlaDh_PNT_C DUF1776 UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 515321
NCBI-ProteinID: NP_001029660
BGD-bta: BT10535
Ensembl: ENSBTAG00000002526
UniProt: Q3T046
Position
6
AA seq 245 aa AA seqDB search
MGRLDGKVIVLTAAAQGIGRAAALAFAKEGAKVIATDINDSKLQELDKYPGIHTRVLDVT
KKKQIDQFANDIERLDVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKM
MAQKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYITGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaggtcattgtcctgacggctgctgctcaggggatcggccgg
gcagccgcattggcttttgcaaaagaaggtgccaaagtcatagccaccgatatcaatgac
tccaaacttcaggaactggataagtacccaggtattcacactcgggtccttgatgtcaca
aagaagaagcaaattgaccagtttgccaatgacattgagagacttgatgttctctttaac
gttgctggtttcgtccatcacggaaccatcctggactgtgaagagacagactgggacttc
tcgatgaacctcaacgtccgcagcatgtacctgatgatcaaggcttttcttcctaagatg
atggctcagaaatctggcaacattatcaacatgtcctctgtggcttccagcatcaaaggc
gttgtgaacaggtgcgtgtacagcacaaccaaggcggccgtgatcggcctcacaaagtcc
gtggctgcagacttcatccagcagggtatccggtgcaactgtgtgtgtccaggaacagtt
gataccccatctctgcaagaaagaatacaagccagaccaaatcctgaagaggcactgagc
gatttcctaaagagacagaaaacaggaagatttgcaactgcagaagaagtagccctgctc
tgcgtgtacttggcctctgatgaatctgcctacatcacggggaatcctgtcatcattgat
ggaggctggagtttgtga

DBGET integrated database retrieval system