KEGG   Bos taurus (cow): 515338Help
Entry
515338            CDS       T01008                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    515338 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    515338 (ACACB)
   00640 Propanoate metabolism
    515338 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    515338 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    515338 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    515338 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    515338 (ACACB)
Enzymes [BR:bta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     515338 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     515338 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
17
AA seq 2431 aa AA seqDB search
MSDSKQVTKSKRKVSFTPSQEPIPASEGSQEPPQEDCNSSPLPKTPSQAELASHKGPQDT
CQQRPSQSPLPQNPQGNPLSSDDASPARQANGSETEGPEIPNTNDLSAPARPQGQRARTL
SREDRKQAHIKRQLMTNFILGSFDDNSSDEDAGAALFRQSSRKGSRASLGTLSLETAHAA
GETETCAPVIRPSMSGLHLARRGREQKKVDLHRDFTVASPAEFVTRFAGHLVIEKVLIAN
NGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADQYVPVPGGPNNN
NYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELLRKHEIAFLGPPSEAMWALGDKIA
STIVAQTLQIPTLPWNGSGLTVEWAEHSLQEGQRISIPESVYNNGCVKDVDEGLEAAEKI
GFPLMIKASEGGGGKGIRKAETAEDFPILFRQVQSETPGSPVFLMKLAQRARHLEVQILA
DQYGNAVSLFGRDCSIQRRHQKIIEEAPATIATPAVFEFMEQCAVRLAKTVGYVSAGTVE
YLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESP
WGVTPISFETPSNPPIPRGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVA
ATGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLTNLLETENFQ
NNDIDTSWLDNLIAEKVQAEKPDIMLGVVCGALNVADSMFRTCMTDFLHSLERGQVLPAD
SLLNIVDVELIYGGVKYILKVARQSPTMFVLIMNGSHIEIDAHRLNDGGLLLSCSGNSYT
TYLKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLVKYTVADGEHVEAGGSYAEIEV
MKMTTTLNVQESGRVKYVRRPGAVLEAGCVVARLELDDPSKVRPAEPFTGELPSQPTLPI
LGEKLHQVFHSVLENLTNIMNGYCLPEPIFSIKLKDWVQKLLRALRHPSLPLLELQEIMT
SVSGRVPAPVEKAVRRVMAQYASNITSVLCQFPSQQIATILDCHAATLQRKADREVFFMN
TQSIVQLVQKYRSGARGYMKAVVLDLLRRYLLVEHHFQQAHYDKCVINLREQLKPDMAQV
LDCIFSHSQVAKKNQLVIMLIDELCGPDPSLSDELTSILDELTQLSKSEHCKVALRARQV
LIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETTIFDVLPTFFYHANKV
VCMASLEVYVRRGYIAYELTSLQHRQFPDGTCVVEFQFMLPSSHPHRMTVPISVTNPELL
RHSTELFMDSGFSPKSQRMGAMVAFQRFEDFVRNFDEVISCFANMPKDTPLFSEARNSLY
SEDDSKSLREEPIHILNVALQHADHQEDEQLVPIFRTFVQSKKNILVECGLRRITFLIAQ
EKEFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRLRNFDVTAMPCANHKMHLYLGAA
RVKEGAEVTDHRFFIRVIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNNTSVRT
DCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAEVKINIRQTTADSAIPI
RLFITNESGYYLDISLYKEVTDPRSGNILFHSFGNKQGPQHGMLINTPYVTKDLLQAKRF
QAQSLGTTYVYDFPEMFRQALFKMWPSPDKYPKDILTYTELVLDPQGQLVEMNRLPGGNE
VGMVAFKMTLKTLEYPEGRDIILISNDITFRIGSFGPGEDLLYLRASELARAEGIPRVYL
AANSGARIGLAEEIKHMFQVAWVDPEDPHKGIKYLYLTPQDYTRISSLNSVHCKHVEEDG
ESRYVITDIIGKEEGLGVENLRGSGMIAGETSQDYDEIVTISMVSCRALGIGAYLVRLGQ
RVIQVENSHIILTGATALNKVLGRDVYTSNNQLGGVQIMHHNGVSHVTVPDDFEGVCTIL
EWLSYMPKDNRSPVPVVTPKDPIDREIEFQPSRGPYDPRWLLAGRPHPTLKGSWQSGFFD
QGSFKEIMVPWAQTVVTGRARLGGIPVGVIAAETRTVELVVPADPANLDSEAKIIQQAGQ
VWFPDSAYKTAQAIKDFNREKLPLMIFANWRGFSGGMKDMYDQVLKFGAYIVDGLRKYRQ
PVLIYIPPYAEVRGGSWAVMDTSINPLCIEMYADRESRASVLEPEGTVEIKYQKKDLVKT
IRRLDPISKKLVEQLGVSELSDTDRKELEGQLKAREDLLLPMYHQVALHFADLHDTAGRM
LEKGVIYDILEWKTARSFLYWRLRRLLLESQVKQEVLRACPELSHMHVQSMLRRWFVETE
GAVKAYLWDNNQTVVQWLEAHGQASEGLHSTIRENITCLRRDSALKTIQGLVQENPELAM
DSLVYVSQHISPAERAQVIHLLSTTDGPAST
NT seq 7296 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactccaagcaagtcaccaagagtaaacggaaagtgagcttcaccccgagtcag
gagccgattccagcctcagagggatcccaggagccaccgcaggaagactgcaacagcagc
cctctgccaaagacccctagccaggctgagctggcctcccacaaaggaccccaagacacc
tgccagcagaggccctcccaatcacctctgccacagaatccccaaggaaaccccctctcg
tctgatgacgcctccccagcacgccaagccaacgggtcagagactgaaggcccggagatc
ccaaataccaatgacctgtccgcgccagccaggccccagggccagcgagccagaaccctc
tccagagaagacaggaagcaggcacacatcaagagacagctgatgaccaacttcatcctg
ggctcttttgatgacaactcctccgatgaagatgctggtgctgccctgttccgacagtct
tcccggaagggcagccgggccagcctggggaccctgtccctggagactgctcatgccgca
ggcgagactgagacctgtgcccccgttataaggcccagcatgtcggggctccacctggca
agaaggggccgagaacagaagaaagtggacctgcacagagacttcaccgtggcttcccct
gctgagttcgtcacacgctttgcggggcatctggtcatcgagaaggtgctcatcgcgaac
aacggtattgccgccgtgaaatgcatgcgctccatccgcaggtgggcctatgagatgttc
cgaaatgagcgggccatccggttcgtagtcatggtaacgccagaggacctcaaggccaac
gcagagtatatcaagatggcagatcagtatgtccctgtcccaggagggcccaacaacaac
aattacgccaacgtggagctgattgtagacatcgccaagaggatccccgtgcaggcggtg
tgggctggttggggccatgcttctgaaaaccccaaacttccggagctcctgcgcaagcac
gagattgctttcctaggccctcccagcgaggccatgtgggcactaggagacaagattgcc
tccaccatcgtggcccagactctgcagatcccaacgctgccctggaacggaagtggtctg
acggtggagtgggcggaacacagtctacaggaggggcaaaggatcagcatcccagagtcc
gtctacaacaatggttgcgtgaaagatgtagatgaaggcttggaggcagcagaaaaaatt
ggttttcccttgatgatcaaagcttctgaaggcggtggagggaaaggaatccggaaggcg
gagactgctgaggacttccccatcctgttcagacaagtgcagagcgagacccctggctcc
ccagtcttcctcatgaagctggcccagcgtgcccggcacctggaggtccagatcctcgcc
gaccagtacgggaacgcagtgtccctgttcgggcgtgactgttccatccagcggaggcac
cagaagatcatagaggaggcgccggccaccattgccacgccagccgtgttcgagttcatg
gagcagtgtgccgtgcgcctggccaagacggtgggctacgtgagcgcggggactgtcgag
tacctttacagccaggatggcagcttccacttcttggagctgaatccccgcctgcaggtg
gaacatccctgcacggaaatgatcgcggatgtcaacctgcctgctgcccagctgcagatt
gccatgggtgtgccgctgcaccggctgaaggatatccggcttctgtacggagagtccccg
tggggggtgacgcccatttcttttgagacccctagcaaccctcccattccccgaggccac
gtcattgcagccagaatcaccagcgaaaacccagatgaggggtttaagccgagctccgga
acggtccaagaattgaatttccgcagcagcaagaatgtatggggttatttcagcgtggct
gcgactggtggcttacacgaatttgcggattcccagtttgggcactgcttttcctggggg
gagaaccgggaagaggccatttcgaacatggtggtggctttgaaggaactatccatcagg
ggcgacttcaggaccaccgtggaatatctcaccaaccttctggagactgagaactttcag
aacaacgacattgacaccagctggttggataacctcattgctgagaaagtgcaggctgag
aagccagatatcatgctcggggttgtgtgcggagccttgaacgtggccgactccatgttt
agaacatgcatgacggacttcctacactcgctggaaaggggccaggtcctccccgcagac
tctctgctgaacatcgtggacgtggaattaatctatggaggtgtcaagtacattctcaag
gtggcccggcagtctccgaccatgttcgtgctcatcatgaacggctctcacatcgagatc
gacgcccaccggctgaacgacggggggctactgctgtcctgcagcggcaacagctacacc
acctacctgaaggaggaggtggacagttaccgaatcaccattggcaacaagacgtgcgtg
tttgagaaggagaatgaccccacagtcctgagatccccttcggctgggaagctggtgaag
tacactgtggcagacggggaacacgttgaggctgggggcagctacgccgagatagaggtc
atgaagatgaccacgaccctgaacgtgcaggaaagtggccgggtgaagtatgtcaggcgc
ccgggggctgtgttggaagctggctgcgtggtggccaggctggagctcgatgacccttct
aaagtgcgcccggctgagccgttcacgggggagctcccctcacagcccacgctgcccatc
ctcggagagaagctgcaccaggtttttcacagcgtcctggaaaatctcaccaacatcatg
aatggctactgtctgccggagcctatttttagcatcaagctgaaggactgggtgcagaag
ctcctgagggccctccggcacccgtcgctgccgctgctggagcttcaggagatcatgacc
agtgtgtcgggccgcgttcccgcccccgtggagaaggccgtccgcagggtgatggcccag
tacgccagcaacatcacctcggtgctctgccagttccccagccagcagatagccaccatc
ctggactgccacgcagccaccctgcagcggaaggccgaccgggaggtcttcttcatgaac
acccagagcattgtacagctggtccagaagtaccgcagtggggcccgcggctacatgaag
gcggtggtcttggacctcctgcggagatatttactggttgagcaccatttccagcaagcc
cactacgacaagtgtgtgataaacctccgggagcagctgaagccagacatggcccaggtg
ttggactgcatcttctcccactcgcaggtggccaagaagaaccagctggtgatcatgttg
attgatgagctctgtggcccagacccatccctgtccgatgagctgacctccatcctcgac
gagctgactcagctgagcaaaagcgagcactgcaaggtggccctcagagccaggcaggtc
ctgattgcctcccatctcccctcctacgagctgaggcacaaccaagtggagtccattttc
ctgtctgccattgacatgtacggccaccagttctgcccagaaaacctcaagaaattaata
ctctcagaaacaaccatctttgatgtgctgcccactttcttctaccacgctaacaaagtg
gtttgcatggcatccttggaggtctatgtgcggaggggctacatcgcctatgagctaacc
agcctgcagcaccgccagttcccggatggcacctgcgtggtggaattccagttcatgctg
ccctcctcccacccgcaccggatgaccgtgcccatcagtgtcaccaacccggaactgctg
agacacagcacggagctcttcatggacagtggcttctcccccaagtcccagcgaatgggg
gccatggtcgccttccagagattcgaggatttcgtcaggaactttgatgaggtcatctcc
tgctttgccaacatgcccaaggacacccccctcttcagcgaggcccggaattccctgtac
tctgaggacgacagcaagagcctccgagaggagccaatccacatcctaaatgtggccctc
cagcacgcggaccaccaggaggatgagcagctggtgcccattttccgaacattcgtgcag
tccaagaaaaacatccttgtggagtgtggactccgaagaatcacattcctgattgcccaa
gagaaagaatttcccaagtttttcacattcagagcaagagatgagtttgcagaagatcgc
atctaccgtcacttggagccggccctggccttccagctggagctcagccggttgcgaaac
ttcgacgtgaccgccatgccctgcgccaaccacaagatgcacctgtacctgggtgccgcc
agagtgaaggagggcgccgaggtcacggaccacaggttcttcatccgggtcatcatcagg
cactcagacctgatcaccaaggaagcctccttcgagtacctccagaacgagggcgagcgg
ctgctcctggaggccatggacgagctggaggtggcattcaacaacaccagcgtgcgcaca
gactgcaaccacatcttcctcaacttcgtgcccaccgtcatcatggacccctccaagatt
gaggagtcggtgcggtccatggtgatgcgctacggcagccgcctctggaagctccgcgtg
ctccaggctgaggtcaagatcaacatccgccagaccaccgccgacagcgccatccccatc
cgcctcttcatcaccaacgagtcaggctactacctggacatcagcctctacaaggaagtg
accgaccccagatctggaaacatcttgtttcactcctttggcaacaagcaaggcccccag
catgggatgctgatcaacactccctatgtcaccaaggatctgcttcaggccaagcgattc
caggcccagtccctgggtaccacctatgtgtatgacttcccagaaatgttcaggcaggct
ctttttaaaatgtggccctctccggacaagtaccccaaagacatcctgacgtacaccgaa
ctcgtgctggatccgcagggccagctggtggagatgaaccgacttcctggaggaaatgag
gtgggcatggtggccttcaaaatgacgttgaagaccctcgagtaccccgaagggcgtgac
attatcctcatcagcaatgacatcaccttccgtatcggatcctttggccccggagaagac
cttctgtacctgcgggcgtctgagctggcccgggccgagggcatccccagagtctacctc
gcggccaacagtggggcccgtatcggcctggcagaggagatcaagcacatgttccaggtg
gcttgggtggacccggaagacccccacaagggaattaaatacctgtacctgaccccccaa
gactacaccagaatcagctccctgaactccgtccattgtaaacacgtggaggaagatgga
gaatccaggtatgtcatcacggacatcattgggaaggaggagggcctgggcgtagagaac
ctgaggggctcaggcatgattgctggggagacctcccaggactacgacgagatcgtcacc
atcagcatggtgagctgccgggccctcgggatcggggcctacctggtgaggctgggccag
cgagtgatccaggtggagaattcccacatcatcctcacgggggcgacggcgctcaataag
gtcctgggcagagacgtttacacgtccaacaaccagctgggcggtgtgcagatcatgcat
cacaatggcgtctcgcatgtcaccgtgccagatgactttgagggtgtttgtaccatcctg
gaatggctgtcctatatgccaaaggataatcgcagcccagtcccagtcgtcacacccaag
gaccccattgacagagaaattgaattccaaccatctcgcgggccctacgacccccggtgg
ctgcttgcaggaagacctcacccaactctgaagggatcctggcagagtggattctttgac
cagggcagtttcaaggagatcatggtgccctgggcccagactgtggtgacgggacgagca
aggctggggggtatccccgtcggagtgatagctgcagagacgcggacggtggagttggtt
gtgcccgccgaccctgccaacctggattccgaggccaagataatccagcaggctggccag
gtgtggttcccagattcggcctataagacggcccaggccatcaaggatttcaaccgggag
aagttgcccctgatgatctttgccaactggagggggttctccgggggcatgaaagacatg
tatgaccaggtgctaaagttcggagcctacatcgtggatggcctccggaagtacagacag
cccgtcctgatctacatcccgccctatgcggaggtccggggcggctcctgggcagtcatg
gacacctccatcaacccgctgtgcatagagatgtacgcggacagagagagcagagcaagt
gttctggagccagagggaacagtggagattaagtaccagaagaaagatctggtgaagacc
atcagaagactcgaccccatttccaagaagctcgtggaacagctcggagtgtctgagctc
tcagacacggaccgcaaggagctggagggccagctgaaggcccgggaggacctgctgctg
cccatgtaccaccaggtggcgctgcactttgccgacctccacgacacggcgggcaggatg
ctggagaagggcgtcatttacgacatcctggagtggaagacggcccgcagcttcctgtac
tggcgcctgcgccgcctgctgctggagagccaggtgaagcaggaggtcctgagggcctgc
cccgagctcagccacatgcatgtgcagtccatgctgcgccgctggtttgtggagacggag
ggcgctgtcaaggcctacctgtgggacaacaaccagacggtggtgcagtggctggaggcg
cacgggcaggcgagcgaggggctgcactccaccatccgggagaacatcacgtgcctgagg
cgggactccgccctcaagaccatccagggcctggttcaagaaaaccccgagctggccatg
gactcactggtgtacgtcagccagcacatcagcccggccgagcgggcccaggtcattcac
ctcctgtccaccacggacggcccggcctctacctga

DBGET integrated database retrieval system