KEGG   Bos taurus (cow): 515515Help
Entry
515515            CDS       T01008                                 

Gene name
SYK
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04064  NF-kappa B signaling pathway
bta04072  Phospholipase D signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04380  Osteoclast differentiation
bta04611  Platelet activation
bta04625  C-type lectin receptor signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04662  B cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04666  Fc gamma R-mediated phagocytosis
bta05152  Tuberculosis
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    515515 (SYK)
   04072 Phospholipase D signaling pathway
    515515 (SYK)
   04151 PI3K-Akt signaling pathway
    515515 (SYK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    515515 (SYK)
   04625 C-type lectin receptor signaling pathway
    515515 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    515515 (SYK)
   04662 B cell receptor signaling pathway
    515515 (SYK)
   04664 Fc epsilon RI signaling pathway
    515515 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    515515 (SYK)
  Development
   04380 Osteoclast differentiation
    515515 (SYK)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    515515 (SYK)
  Infectious diseases
   05152 Tuberculosis
    515515 (SYK)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    515515 (SYK)
   05169 Epstein-Barr virus infection
    515515 (SYK)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     515515 (SYK)
Protein kinases [BR:bta01001]
 Non-receptor tyrosine kinases
  SYK family
   515515 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 515515
NCBI-ProteinID: NP_001032542
BGD-bta: BT18159
Ensembl: ENSBTAG00000004767
UniProt: Q32PK0
Position
8
AA seq 605 aa AA seqDB search
MGDGANNLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHDRKAHHYT
IERELNGTYAITGGRAHGSPAELCHYHTQELDGLVCLLKKPFNRPPGVQPKTGPFEDLKE
NLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIG
SKTNGKFLIRAKDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSY
KSDGLLRVLTVPCQKIGGQSGNINFRPQLPSSHPGTRTSSGNQVDSSTTFNPYEPDRGPW
ANEREAQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYY
QMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEM
AELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECNFVHRDLAARNVLLVTQHYAKI
SDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQ
KPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTLCWTYDVENRPGFVAVELRLRNYY
YDVVN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacggcgccaacaacctgcccttcttcttcggcaacatcactcgggaggaggcg
gaagactacctggtccaggggggcatgagcgatgggctctacctgctgcgccagagccgc
aactacctgggtggctttgccctgtcagtggcacacgacagaaaggcacatcactacacc
atcgagagggagctgaatggcacctatgccatcacgggtggccgggcccatggcagtcca
gccgagctctgccactaccacacccaggagctggatggcctcgtctgcctcctcaagaag
cccttcaaccggccgccgggggtgcagcccaagactggaccctttgaggacttgaaggag
aacctcatccgagaatacgtgaaacagacatggaacctacagggtcaagctcttgagcag
gccatcatcagccagaaacctcagctggagaaactgatcgccaccacagctcatgaaaaa
atgccctggttccatggaaaaatctctcgggatgaatctgagcagattgtcctgatagga
tcaaagacgaatggaaagttcttgatcagggccaaggacaacgggtcctacgccctgtgc
ctgctgcacgagggcaaggtgctgcactaccgcatcgacaaggacaaaacggggaagctc
tccatccctggcgggaagaatttcgacacactctggcagctggtcgagcattattcttat
aaatcagatggtttgttaagagttcttacagttccatgtcaaaaaattggcgggcaatcg
ggaaatattaacttccgtccacaacttccaagttctcatcctgggacccgcacatcctca
gggaaccaggtggatagttctacaacattcaacccttacgagccagaccgaggaccgtgg
gccaacgagagagaagctcagagagaagccttgcccatggacactgaggtctacgaaagc
ccctatgcagaccccgaggagatccggcccaaggaggtctacctggaccggaagctgctg
accctggaggacaaggaactgggctctgggaactttgggactgtgaagaagggctattac
cagatgaaaaaagttgtgaaaacagtggctgtgaaaatcctgaaaaatgaggccaatgac
cctgctcttaaggatgagttattagcagaagcgaatgtcatgcagcagcttgacaaccct
tacattgtgcgcatgatagggatatgtgaagctgagtcctggatgctggtcatggagatg
gcagaacttggtccactcaacaaatatttacaacagaacaggcatgtcaaggataaaaac
atcatagagctggttcatcaggtgtctatgggaatgaaatatttggaagaatgcaatttt
gtgcacagagatctggctgcaaggaatgtcttgctggttactcaacattatgccaagatc
agtgattttggactttccaaagcacttcgtgctgatgaaaactactacaaggcccagacc
cacggaaagtggcctgtgaagtggtatgctccggaatgcatcaactactacaagttctcc
agcaagagtgatgtttggagcttcggagtgttgatgtgggaagcgttttcctacgggcag
aagccatatcggggaatgaaaggcagtgaagtttctgctatgctggagaaaggagagagg
atggggtgcccaccagggtgtccgagagagatgtacgagctgatgaccctgtgctggacc
tatgacgtggagaacaggcctggattcgtagctgtggaactgcggctgcgcaattactac
tacgacgtggttaactaa

DBGET integrated database retrieval system