KEGG   Bos taurus (cow): 515515Help
Entry
515515            CDS       T01008                                 

Gene name
SYK
Definition
spleen tyrosine kinase (EC:2.7.10.1)
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
bta  Bos taurus (cow)
Pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:bta04064]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:bta04650]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:bta04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:bta04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:bta04666]
Organismal Systems; Development; Osteoclast differentiation [PATH:bta04380]
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Infectious diseases; Tuberculosis [PATH:bta05152]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
8
AA seq 605 aa AA seqDB search
MGDGANNLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHDRKAHHYT
IERELNGTYAITGGRAHGSPAELCHYHTQELDGLVCLLKKPFNRPPGVQPKTGPFEDLKE
NLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIG
SKTNGKFLIRAKDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSY
KSDGLLRVLTVPCQKIGGQSGNINFRPQLPSSHPGTRTSSGNQVDSSTTFNPYEPDRGPW
ANEREAQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYY
QMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEM
AELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECNFVHRDLAARNVLLVTQHYAKI
SDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQ
KPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTLCWTYDVENRPGFVAVELRLRNYY
YDVVN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacggcgccaacaacctgcccttcttcttcggcaacatcactcgggaggaggcg
gaagactacctggtccaggggggcatgagcgatgggctctacctgctgcgccagagccgc
aactacctgggtggctttgccctgtcagtggcacacgacagaaaggcacatcactacacc
atcgagagggagctgaatggcacctatgccatcacgggtggccgggcccatggcagtcca
gccgagctctgccactaccacacccaggagctggatggcctcgtctgcctcctcaagaag
cccttcaaccggccgccgggggtgcagcccaagactggaccctttgaggacttgaaggag
aacctcatccgagaatacgtgaaacagacatggaacctacagggtcaagctcttgagcag
gccatcatcagccagaaacctcagctggagaaactgatcgccaccacagctcatgaaaaa
atgccctggttccatggaaaaatctctcgggatgaatctgagcagattgtcctgatagga
tcaaagacgaatggaaagttcttgatcagggccaaggacaacgggtcctacgccctgtgc
ctgctgcacgagggcaaggtgctgcactaccgcatcgacaaggacaaaacggggaagctc
tccatccctggcgggaagaatttcgacacactctggcagctggtcgagcattattcttat
aaatcagatggtttgttaagagttcttacagttccatgtcaaaaaattggcgggcaatcg
ggaaatattaacttccgtccacaacttccaagttctcatcctgggacccgcacatcctca
gggaaccaggtggatagttctacaacattcaacccttacgagccagaccgaggaccgtgg
gccaacgagagagaagctcagagagaagccttgcccatggacactgaggtctacgaaagc
ccctatgcagaccccgaggagatccggcccaaggaggtctacctggaccggaagctgctg
accctggaggacaaggaactgggctctgggaactttgggactgtgaagaagggctattac
cagatgaaaaaagttgtgaaaacagtggctgtgaaaatcctgaaaaatgaggccaatgac
cctgctcttaaggatgagttattagcagaagcgaatgtcatgcagcagcttgacaaccct
tacattgtgcgcatgatagggatatgtgaagctgagtcctggatgctggtcatggagatg
gcagaacttggtccactcaacaaatatttacaacagaacaggcatgtcaaggataaaaac
atcatagagctggttcatcaggtgtctatgggaatgaaatatttggaagaatgcaatttt
gtgcacagagatctggctgcaaggaatgtcttgctggttactcaacattatgccaagatc
agtgattttggactttccaaagcacttcgtgctgatgaaaactactacaaggcccagacc
cacggaaagtggcctgtgaagtggtatgctccggaatgcatcaactactacaagttctcc
agcaagagtgatgtttggagcttcggagtgttgatgtgggaagcgttttcctacgggcag
aagccatatcggggaatgaaaggcagtgaagtttctgctatgctggagaaaggagagagg
atggggtgcccaccagggtgtccgagagagatgtacgagctgatgaccctgtgctggacc
tatgacgtggagaacaggcctggattcgtagctgtggaactgcggctgcgcaattactac
tacgacgtggttaactaa

DBGET integrated database retrieval system