KEGG   Bos taurus (cow): 515770Help
Entry
515770            CDS       T01008                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bta  Bos taurus (cow)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bta00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYYLSRAPCPPKVVLVEGSERLGGWIRSVRGPDGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPSGIRGLLRPSP
PFSKPLFWAGLRDLTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRGPQLDSALIRQAQAERWSQWSLRGGLETLPQAL
HAHLTSRGVSVLQGQPVCGLSLQAEGRWKVSLEDSSLEADHIISAIPASVLSKLLPAEAT
PLARALSTITAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPVILGIVYDSVAFPEQDGSL
PGLRLTVMLGGSWLQTLEARGCVLSQELLQQEAEKAAATQLGLNEPPSHCLVHLHKNSIP
QYTLGHWQKLESAAQFLAAQKLPLTLAGASYEGVAVNDCIESGRQAAARVLGTEPNS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggagggatcagcggcttggccgccagttactat
ctgagccgggccccctgtccccccaaggtggtcttggtggagggcagcgagcgcctggga
ggctggatccgctcagtacgagggccagatggtgccatttttgaacttggacctcgagga
attcggccggcaggagccctgggagcccggaccctgctcctggtttctgagcttggcttg
gactcagaagtgttgccggtccggggagaccatccagctgcccagaacaggttcctgtat
gtaggtggtgctctgcatgccttgccctctggcatcagggggctcctccgcccttcacct
cctttctccaaacctctgttctgggctgggctgagggatttgaccacccctcgtggcaaa
gaccctgatgagactgtgcacagttttgcccagcgccgccttggtcccgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccatcgttccatattactgggg
ctgctgctgggggcaggccggggcccacagctggactcagcacttattcgccaagctcag
gctgagcgctggagccagtggtcactccgtggagggctggagacattgccccaggccctc
cacgcccacctgactagtaggggtgtcagtgttctccaaggccagccagtctgtgggctc
agtctccaggcagaagggcgctggaaggtgtctctagaggacagcagcctggaggctgac
cacattattagtgccattccagcttcagtgctcagcaagctgctccctgctgaggccaca
cctctggcccgtgccctgagcaccatcactgctgtgtctgtggctgtggtgaatctgcag
taccgaggagctcgtctgcctgtccagggatttggacatttggtgccatcctcagaagat
ccagttatcctgggaattgtgtatgactccgttgctttccctgagcaggatgggagcctg
cctggcctcagactgactgtgatgctgggaggttcctggttacagacactagaagccagg
ggctgtgtcttatctcaggagctgctccaacaggaggcagagaaagctgctgccactcaa
ttaggactgaatgagccaccaagtcactgcttggtccatctacacaagaactctatcccc
cagtatacattaggccactggcaaaaactggagtcagctgcccaattcctggctgctcag
aagctgcctttgactctggctggggcctcctatgagggggttgctgtcaatgactgtata
gagagcgggcgtcaggcagcagcccgtgtcttgggcacagaacccaacagttga

DBGET integrated database retrieval system