KEGG   Bos taurus (cow): 515928Help
Entry
515928            CDS       T01008                                 

Gene name
SETD7, SETD7-1, SETD7-2
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    515928 (SETD7)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    515928 (SETD7)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     515928 (SETD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 408 aa AA seqDB search
MMRQRGDTCAPGSAPALAQPPRAPGGTRGSRAAPSWAGSPAAMDSDDEMVEEAVEGHLDD
DGLPHGFCTVTYSSTDRFEGNFIHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYED
GGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGE
MTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLLSTEEGRPHFELMPGSSVYHFDKSTS
SCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAAGPDTVMSFYNGVRITHQEVDSR
DWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCVYDMFVHPRFGPIKC
IRTLRAVEANEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggcaacgcggggacacctgcgctcccggttcagccccagcgctcgctcagccg
ccgcgagcacccggagggacgcgaggcagccgcgcggccccgagctgggcagggtcccca
gccgccatggatagcgacgatgagatggtggaggaggcggtggaagggcacctggacgat
gatggattgccgcacggcttctgcacagtcacctactcctccacggacagattcgagggc
aacttcattcacggagaaaagaatggacggggcaagttcttcttctttgatggcagcacc
ctggagggatattatgtggacgatgccctgcagggccagggagtttacacttacgaggat
ggaggagttctccagggcacatatgtagacggagagctgaatggaccggcccaggagtac
gacacagacgggaggctgatcttcaagggacaatacaaagataacattcggcatggagtg
tgctggatatactacccagatggaggcagccttgtaggagaagtaaatgaagatggggag
atgacaggagagaagatagcctacgtgtaccctgatgaaaggacggccctgtatggaaaa
ttcatcgatggagagatgatagaagggaagctggctactcttctgtccactgaagaaggc
aggcctcactttgaactgatgcctggaagttcagtgtaccactttgataagtcaacttca
tcttgcatttctaccaatgctcttcttccagacccatatgaatcagagagggtttatgtt
gctgaatctctcatttccagtgctggagaagggctgttttcaaaggtagctgcgggacct
gacactgttatgtctttttacaatggagtccgaattacacatcaagaggttgacagcagg
gactgggctctcaatgggaacaccctctcccttgacgaggaaacggtcattgatgtgcct
gagccctacaaccatgtatccaagtactgtgcctccttgggacacaaggcaaatcactcc
ttcactccaaactgtgtctatgacatgtttgtccacccccggttcgggcccatcaaatgc
atccgcaccctccgagccgtggaggccaacgaggaactcaccgttgcctatggctacgac
cacagccccccagggaagagcgggccagaagcccccgagtggtaccaggtggagctgaag
gccttccaggccacccagcagaagtga

DBGET integrated database retrieval system