KEGG   Bos taurus (cow): 515928Help
Entry
515928            CDS       T01008                                 

Gene name
SETD7, SETD7-1, SETD7-2
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
FoxO signaling pathway
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bta00310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bta04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 409 aa AA seqDB search
MVPRRVGTQRARGSAPALAQPPRAPGGTRGSRAAPSWAGSPAAMDSDDEMVEEAVEGHLD
DDGLPHGFCTVTYSSTDRFEGNFIHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYE
DGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDG
EMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLLSTEEGRPHFELMPGSSVYHFDKST
SSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAAGPDTVMSFYNGVRITHQEVDS
RDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCVYDMFVHPRFGPIK
CIRTLRAVEANEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggtcccgaggagggtggggacgcagcgcgctaggggttcagccccagcgctcgctcag
ccgccgcgagcacccggagggacgcgaggcagccgcgcggccccgagctgggcagggtcc
ccagccgccatggatagcgacgatgagatggtggaggaggcggtggaagggcacctggac
gatgatggattgccgcacggcttctgcacagtcacctactcctccacggacagattcgag
ggcaacttcattcacggagaaaagaatggacggggcaagttcttcttctttgatggcagc
accctggagggatattatgtggacgatgccctgcagggccagggagtttacacttacgag
gatggaggagttctccagggcacatatgtagacggagagctgaatggaccggcccaggag
tacgacacagacgggaggctgatcttcaagggacaatacaaagataacattcggcatgga
gtgtgctggatatactacccagatggaggcagccttgtaggagaagtaaatgaagatggg
gagatgacaggagagaagatagcctacgtgtaccctgatgaaaggacggccctgtatgga
aaattcatcgatggagagatgatagaagggaagctggctactcttctgtccactgaagaa
ggcaggcctcactttgaactgatgcctggaagttcagtgtaccactttgataagtcaact
tcatcttgcatttctaccaatgctcttcttccagacccatatgaatcagagagggtttat
gttgctgaatctctcatttccagtgctggagaagggctgttttcaaaggtagctgcggga
cctgacactgttatgtctttttacaatggagtccgaattacacatcaagaggttgacagc
agggactgggctctcaatgggaacaccctctcccttgacgaggaaacggtcattgatgtg
cctgagccctacaaccatgtatccaagtactgtgcctccttgggacacaaggcaaatcac
tccttcactccaaactgtgtctatgacatgtttgtccacccccggttcgggcccatcaaa
tgcatccgcaccctccgagccgtggaggccaacgaggaactcaccgttgcctatggctac
gaccacagccccccagggaagagcgggccagaagcccccgagtggtaccaggtggagctg
aaggccttccaggccacccagcagaagtga

DBGET integrated database retrieval system