KEGG   Bos taurus (cow): 516039Help
Entry
516039            CDS       T01008                                 

Gene name
MAP2K3
Definition
mitogen-activated protein kinase kinase 3 (EC:2.7.1.-)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:bta04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bta04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:bta04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:bta04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:bta04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:bta04912]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:bta04750]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:bta05014]
Human Diseases; Infectious diseases; Influenza A [PATH:bta05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:bta05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 347 aa AA seqDB search
MESPAPSPPAGVPTSKGKSRRKKDLRISCMSKPPAPSPTLPRNLDSRAFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDVNMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKGMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTSHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccctgccccgagcccgcccgccggcgtgcccacgtccaaaggaaagtccagg
aggaaaaaggatttacgaatctcctgcatgtccaagccgccggcgcccagccccacgctc
ccccggaacctggactcccgggcattcatcaccattggagacaggaactttgaggtggag
gcggatgacctggtgaccatttcagagctgggccgaggtgcctatggggtggtggagaag
gtgcggcatgcccagagtggcaccatcatggccgtgaagcgcatccgggccaccgtgaac
tctcaggagcagaagcgcctgctcatggacctagatgtcaacatgcgcacggtggactgt
ttctacaccgtcaccttctatggggccctctttagagagggagacgtgtggatctgcatg
gagctcatggacacgtccctggacaagttctatcggaaggtgctagacaagggcatgacg
atcccagaagacattctcggggagatcgctgtgtctatcgtgagggccctggaacacctg
cacagcaagctgtccgtgatccacagagatgtgaagccgtccaatgtccttatcaacaag
gagggccacgtgaagatgtgtgactttgggatcagtggttacttggtggattccgtggcc
aagacaatggatgctggctgcaaaccctacatggcccctgagagaatcaacccagaactg
aaccagaaaggctacaatgtcaagtccgatgtctggagcctcggcatcaccatgatcgag
atggccattctgcgatttccttacgagtcctgggggacccccttccagcagctgaagcag
gtggtagaggagccgtccccccagctcccagctgaccgtttctcccctgagtttgtggac
tttactgcacagtgcctgagaaagaaccccgcggaacgcatgagctacctggagctgatg
gagcaccctttcttcacctcgcacaaaaccaagaagactgacatcgctgccttcgtgaag
gagatcctgggagaggactcgtag

DBGET integrated database retrieval system