KEGG   Bos taurus (cow): 516259Help
Entry
516259            CDS       T01008                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
bta  Bos taurus (cow)
Pathway
Endocytosis
Phagosome
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:bta04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:bta04145]
Human Diseases; Infectious diseases; Tuberculosis [PATH:bta05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
5
AA seq 1410 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSAAPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSSHGGEALALKRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKFQGLQQ
QESKPDGLVADSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDE
ERSLREAAEQQVTHLTEELNKEAAVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMT
LERERESEKLKDECKKLQTEYTNSEAVISQLRSELAKGPQEVAVYVQELQKLKSSVNELT
QKNQNLTEKLQKKELDYTQLEEKHNEECMSKKSIQASLHQKDLDCQQLQSRLSASETSLQ
RIQAELGEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKDQHGLQLQSEINQLHS
KLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEELKEKVTNSTELQH
QLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISL
LEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQ
VQEQKAHLRAAQDRVLSLESSINELNSQLNESKEKVSQLDIQVKAKTELLLSAEAAKTAQ
RADLQNHLDTAQNALQDKQQELNKITTQLDQVTTKLQDKQEHCSQLESHLKEYKEKHLSL
EQKTEELEGQIKKLEADMLEVKASKEQALQGLQQQRQLNTDLELRATELSKQLEMEKETV
SNTKLDLQKKSEALENTKQMLTKQEEEKTMLKQEIENLSQDAKMQHKELNDRIQTAVTEL
QKVKVEKDSLVAELSAAKEKLSKVSDCLKNSQSEFEKENQKGKAVILDLEKTCKELKHQL
QVQTESLHKEQNEMKKSLEKEKETSHQLKLELSSMQGQVIQAQDSLKQKEKEEQQLQSNI
NELKQLTEQKKKQIETLQGEVKIAVSQKTELENKLQQQSMQAAQELAAEKQKISVLQNTY
EKSQENLKQLQSDFYGKESELLATRQDLKSIEEKLSLAQEDLISNRNQIGNQNKLIQELK
TTKTTLEQDLAKKEQQLKEQNKALQDMQKEKSLKEKELVNEKSKLAETEEIKCRQEKEIA
KLSEELKSHKQESIKEITNLKDAKQLLIQQKLELQGKVDSLKATLEQEKKTQQMLKEQMK
KEEDELKKEFMEKEAKLHSEIKEKEVGMKKHEENGAKLTMQITALNENLGTIKKEWQSSQ
RRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLD
NTTAAVQELGRENQSLQIKHTQALTRKWAEDSEVQNCMACGKGFSVTVRRHHCRQCGNIF
CAECSAKNALTPSSKKPVRVCDGCFNDLQG
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaggattctacagaggactcctgggagagttggctctcaaggttcagatcta
gattcatcagcagctcctataaacacagtggatgtcaataatgaaagctcttcagagggt
ttcatatgtccacagtgtatgaaatctcttggatctgctgatgaacttttcaaacactat
gaggcagtccatgatgctggtaatgactcaagtcacggaggagaagctttggctctgaag
cgagatgatataacactactcagacaagaggtccaagacctacaggcttcacttaaggaa
gaaaaatggtactcagaagaattaaagaaagaattagaaaaatttcaagggctgcagcaa
caagagtccaaacctgatggattagtggctgattcatcagcagaactacagtctttggaa
caacaattagaagaagcccaaacagaaaattttaatattaaacaaatgaaagatttgttt
gaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaaatatgatgaa
gaaaggagtcttagagaagctgctgaacagcaagtgacacatctaacagaagaattaaac
aaagaagcagctgtgattcaagatctaaagactgaactgcttcagagacctggaatagaa
gatgttgctgtattaaagaaagaactggtccaagttcaaacactaatggataacatgacc
ttggaacgtgagagagaatctgaaaaactcaaagatgagtgcaaaaagttacaaacagaa
tatactaactcagaggccgtaataagccagctgaggagtgaacttgccaaaggcccgcag
gaagttgctgtgtatgtgcaggaactacaaaaacttaaaagttcagttaatgaattaaca
caaaaaaatcagaacttgactgaaaagttacagaagaaagaactggactatactcagtta
gaagagaaacataatgaagaatgtatgagtaaaaagagtatacaagcaagccttcatcaa
aaagacctggattgtcaacagcttcagtcaaggttatctgcatctgaaacctcactgcag
agaatacaggcagaactaggtgaaaagggagaagctactcagaagctcaaagaagaatta
tcagaagtggagaccaagtaccagcatcttaaggcagagtttaaacagctacaacaacag
agagaagaaaaggatcagcatgggttacaactgcaaagtgaaatcaatcaattacatagc
aaacttctggagacagagcgccaactaggagaagctcatggaaggctgaaggaacagaga
cagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatctacaactcaaa
ctttctcgtttagaggaagagttgaaggaaaaagtaaccaattccacagaattgcagcat
cagttagataaaacaaagcaacagcatcaagaacaacaagctcttcaacaaagcactaca
gcaaaacttcgagaagctcagaatgatttggaacaagtactacgtcaaattggtgataag
gaccaaaagatccagaaccttgaagccttattacagaagagcaaagaaaatatttcttta
ctagaaaaggagagagaagatctttatgcaaaaattcaggctggtgagggagagactgct
gttcttaaccaattacaagaaaaaaaccatacattacaggaacaagtaactcagctaaca
gagaagctgaagaatcagtcagaaagccataaacaagcccaggagaatttgcatgaccag
gtgcaggagcagaaggcacatcttagagctgcacaagaccgtgtcctttccctagaatcc
agcatcaatgaattaaatagtcagttaaatgaaagcaaggagaaggtttcccagcttgat
atacaggttaaagccaaaactgaattattgctatcagcagaagcagcaaaaactgctcag
agagcagatcttcagaatcatctggacacagcccaaaatgcattacaagataaacagcag
gagttaaataagatcactactcagttggatcaggtcactacaaagttgcaggacaagcaa
gaacattgcagtcagctggaaagtcatcttaaagaatacaaagagaaacatctgtcttta
gaacagaaaactgaagaattagaaggtcaaatcaagaaactagaagctgatatgcttgaa
gttaaagcaagcaaggagcaagctttgcagggtctacaacaacagagacagctgaacaca
gatttagagcttcgagccacagaattgagtaaacaacttgaaatggagaaagaaacagta
tctaatacaaagttggatctacagaagaaatctgaagcacttgaaaatactaagcaaatg
cttaccaagcaagaagaagaaaaaacaatgcttaaacaagaaattgaaaatttaagtcaa
gatgcaaagatgcagcacaaggaactgaatgataggattcaaacagcagtaacagaacta
cagaaagtgaaggtggagaaagactctctggtagcagagctttctgcagcaaaagagaaa
ctgtcaaaagtttctgattgtttgaagaactcccaaagtgaatttgaaaaagaaaatcag
aagggaaaagctgttatattagatttggagaaaacttgcaaagaattaaagcatcagctt
caagtacagacagaaagcctgcataaggagcagaatgaaatgaaaaagtcacttgaaaaa
gaaaaggagacttctcatcagttgaagttggagctcagttccatgcagggacaagtcata
caggcccaggacagcttaaaacaaaaggaaaaagaagaacaacagcttcagagtaacata
aatgagctaaagcaattgactgaacagaagaaaaagcaaattgaaacactccaaggagaa
gttaaaattgctgtttcacagaagacagaacttgagaataaactacagcagcagtcaatg
caagcagcacaggaacttgcagcagagaaacaaaaaatatcagtgttacaaaacacctat
gaaaaaagtcaggaaaatctaaaacagcttcagtcggatttctatgggaaggaatctgaa
ctacttgccacaaggcaggatcttaagtctatagaagagaagctttctctagcacaggag
gatttgatatcaaacagaaatcaaattggaaaccaaaataaattgattcaagaactgaag
accaccaagactactttggagcaagatttagcaaagaaagaacagcaattgaaggaacag
aataaagcactacaagatatgcaaaaagaaaagtcactaaaagaaaaagaactagtaaat
gaaaaatctaaattggcagagacagaggaaattaagtgtagacaagaaaaagaaattgct
aaattgagtgaagaactcaagtctcacaagcaggaaagcataaaggaaataacaaatctc
aaggatgccaaacagcttttgattcagcagaaattagagcttcaagggaaagtagattcc
ctgaaggcaacccttgaacaggagaagaaaacccagcaaatgctaaaagagcagatgaaa
aaggaagaagatgagctgaagaaagagtttatggaaaaggaagctaaactgcattccgaa
ataaaagaaaaagaagtaggaatgaagaagcatgaagaaaatggggctaaacttaccatg
cagatcacagcattaaatgaaaacttgggcaccataaagaaagagtggcagtccagtcaa
cggagagtcagtgaactcgagaaacagacggacgacttacggggtgaaattgcagtactg
gaagcgacagttcagaataaccaagatgaaaggagagcactgctggaaaggtgtcttaaa
ggagaaggtgaaatagaaaagcttcaaaccaaagtactagaattgcaaagaaagctggat
aatacaactgcagcagtgcaggagctaggcagagagaatcagtcccttcaaatcaaacat
acacaggcgttgactagaaagtgggctgaagacagtgaagtacaaaactgtatggcctgt
gggaaaggcttttccgtaacagtgagacggcatcactgcagacaatgtggaaatatcttc
tgtgctgagtgttcagccaaaaatgccttaactccttcttccaagaagcctgttcgtgtc
tgtgatggatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system