KEGG   Bos taurus (cow): 516287Help
Entry
516287            CDS       T01008                                 

Gene name
CYB5R1
Definition
cytochrome b5 reductase 1 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bta  Bos taurus (cow)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bta00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
16
AA seq 305 aa AA seqDB search
MGLQPSPVLLASLGVGLLTLLGVALGAYLVRRSRRPPVTLLDPNEKYQLRLLDKTTVNHN
TKRFRFALPTAHHVLGLPVGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKIGDVVEFRGPSGLLTYAGKGKFNIQPNKKAPPEARVARNLG
MIAGGTGITPMLQLIRAILKDPEDPTQCFLLFANQTEKDIILREDLEELQARHPGRFKLW
FTLDHPPEGWAYSKGFVSVDMIREHLPAPGEDVLLLLCGPPPMVQLACHPSLDKLGYSPK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcagccgagcccggtcctgctggcctccctgggcgtggggctgctgacgctg
ctcggcgtggctctgggcgcctacctggtgcggaggtcccgccggccgccggtcacgctc
ctggaccccaatgagaagtaccagctgcgactgctagacaagacgaccgtgaaccacaac
accaagaggttccgctttgccctgccgacggctcaccacgttctggggctgcctgtgggc
aaacatgtctacctctctgcccggatcgatggcagcctggtcatcaggccgtacactccc
gtcaccagcgatgaggaccagggctacgtggatcttgtcatcaaggtctatctgaagggt
gtgcaccccaaattccctgagggagggaagatgtctcagtacctggatagcctgaagatt
ggggacgtggtggagtttcgggggccaagcgggctgcttacttatgccggaaaagggaag
tttaacatccagcccaacaaaaaggctccaccagaagcgcgcgtggccaggaacctggga
atgattgccggaggcacaggaatcactccaatgctgcagctgatccgggccatcctgaaa
gacccagaagatcccacccagtgctttctgctgtttgccaaccagactgaaaaggacatc
atcttacgagaggacttggaggagctgcaggcccgacaccccggccgctttaagctctgg
ttcaccctggatcaccccccagaaggttgggcctacagcaagggcttcgtctctgtggac
atgatccgggagcacctgcccgctcccggggaagacgtgctgctgctgctctgcgggcca
cccccgatggtgcagctggcctgccaccccagcctggacaaactgggctactcgccaaag
atgcgcttcacctactga

DBGET integrated database retrieval system